IL-10 Protein, Canine
Based on 1 Customer Validation
IL-10 is the most important cytokine that inhibits pro-inflammatory responses and limits excessive immune responses in various autoimmune diseases. It belongs to the type 2 cytokine superfamily. IL-10 plays an important role in transmitting information, activating and regulating immune cells, mediating T and B cell activation, proliferation and differentiation, and in inflammatory responses. IL-10 can promote the proliferation and activation of CD8T+ cells, enhancing anti-tumor capabilities. IL-10 Protein, Canine is the recombinant canine-derived IL-10 protein, expressed by E. coli , with tag free.
- Species: Canine
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-10 is the most important cytokine that inhibits pro-inflammatory responses and limits excessive immune responses in various autoimmune diseases. It belongs to the type 2 cytokine superfamily. IL-10 plays an important role in transmitting information, activating and regulating immune cells, mediating T and B cell activation, proliferation and differentiation, and in inflammatory responses. IL-10 can promote the proliferation and activation of CD8T+ cells, enhancing anti-tumor capabilities. IL-10 Protein, Canine is the recombinant canine-derived IL-10 protein, expressed by E. coli , with tag free.
Background
IL-10 is the most important cytokine that inhibits pro-inflammatory responses and limits excessive immune reactions in various autoimmune diseases. IL-10 plays a crucial role in delivering messages, activating and regulating immune cells, mediating T and B cell activation, proliferation and differentiation, and in inflammatory responses. IL-10 can suppress the production of cytokines by TH1 cells and antigen-presenting cells (macrophages and dendritic cells). Additionally, IL-10 not only directly inhibits pro-inflammatory TH17 cells, but also has a direct effect on CD4+Foxp3+ regulatory T cells (Tregs) and promotes their suppressive function. When IL-10 binds to its receptor complex, JAK1 (located on the IL-10Rα chain) and Tyk2 (located on the IL-10Rβ chain) are activated. This further leads to the phosphorylation of STAT3 and the expression of downstream genes such as SOCS-1 and SOCS-3. IL-10 can downregulate the expression of major histocompatibility complex II on monocytes, reducing their antigen-presenting function. It can also downregulate T lymphocyte activity, inhibit the activation, migration, and adhesion of inflammatory cells. At the same time, IL-10 can suppress the synthesis and release of inflammatory cytokines. IL-10 can promote the proliferation and activation of CD8T+ cells, enhancing their anti-tumor capacity[1].
Verified Bioactivity
Measured in a cell proliferation assay using HepG2. The ED50 for this effect is 3.15 ng/mL. corresponding to a specific activity is 3.17×105 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Canine
-
Source E. coli
-
Tag Tag Free
-
Accession
XP_855560 (S20-I179)
-
Molecular Construction
-
N-term
-
IL-10 (S20-I179)
Accession # XP_855560 -
C-term
-
-
Protein Length
Full Length of Interleukin-10 Chain
-
Synonyms
IL10; TGIF; Interleukin 10; T-Cell Growth Inhibitory Factor; IL-10; Interleukin-10; CSIF; Interleukin Family Protein; Cytokine Synthesis Inhibitory Factor; GVHDS; IL10A; IF2A
-
AA Sequence
SRHQSTLPEDDCTHFPASLPHMLRELRAAFGRVKTFFQMKDKLDNILLTGSLLEDFKSYLGCQALSEMIQFYLEEVMPRAENHDPDIKNHVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVEQVKSAFSKLQEKGVYKAMSEFDIFINYIETYMTMRMKI
-
Predicted Molecular Mass
18.8 kDa
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)