IL-10 Protein, Canine

Customer Review

Based on 1 Customer Validation

IL-10 is the most important cytokine that inhibits pro-inflammatory responses and limits excessive immune responses in various autoimmune diseases. It belongs to the type 2 cytokine superfamily. IL-10 plays an important role in transmitting information, activating and regulating immune cells, mediating T and B cell activation, proliferation and differentiation, and in inflammatory responses. IL-10 can promote the proliferation and activation of CD8T+ cells, enhancing anti-tumor capabilities. IL-10 Protein, Canine is the recombinant canine-derived IL-10 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Canine
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-10 is the most important cytokine that inhibits pro-inflammatory responses and limits excessive immune responses in various autoimmune diseases. It belongs to the type 2 cytokine superfamily. IL-10 plays an important role in transmitting information, activating and regulating immune cells, mediating T and B cell activation, proliferation and differentiation, and in inflammatory responses. IL-10 can promote the proliferation and activation of CD8T+ cells, enhancing anti-tumor capabilities. IL-10 Protein, Canine is the recombinant canine-derived IL-10 protein, expressed by E. coli , with tag free.

Background

IL-10 is the most important cytokine that inhibits pro-inflammatory responses and limits excessive immune reactions in various autoimmune diseases. IL-10 plays a crucial role in delivering messages, activating and regulating immune cells, mediating T and B cell activation, proliferation and differentiation, and in inflammatory responses. IL-10 can suppress the production of cytokines by TH1 cells and antigen-presenting cells (macrophages and dendritic cells). Additionally, IL-10 not only directly inhibits pro-inflammatory TH17 cells, but also has a direct effect on CD4+Foxp3+ regulatory T cells (Tregs) and promotes their suppressive function. When IL-10 binds to its receptor complex, JAK1 (located on the IL-10Rα chain) and Tyk2 (located on the IL-10Rβ chain) are activated. This further leads to the phosphorylation of STAT3 and the expression of downstream genes such as SOCS-1 and SOCS-3. IL-10 can downregulate the expression of major histocompatibility complex II on monocytes, reducing their antigen-presenting function. It can also downregulate T lymphocyte activity, inhibit the activation, migration, and adhesion of inflammatory cells. At the same time, IL-10 can suppress the synthesis and release of inflammatory cytokines. IL-10 can promote the proliferation and activation of CD8T+ cells, enhancing their anti-tumor capacity[1].

Verified Bioactivity

Measured in a cell proliferation assay using HepG2. The ED50 for this effect is 3.15 ng/mL. corresponding to a specific activity is 3.17×105 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using HepG2. The ED50 for this effect is 3.15 ng/mL. corresponding to a specific activity is 3.17×105 units/mg.

Technical Parameters

  • Species Canine
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-10 (S20-I179)
      Accession # XP_855560
    • C-term
  • Protein Length

    Full Length of Interleukin-10 Chain

  • Synonyms

    IL10; TGIF; Interleukin 10; T-Cell Growth Inhibitory Factor; IL-10; Interleukin-10; CSIF; Interleukin Family Protein; Cytokine Synthesis Inhibitory Factor; GVHDS; IL10A; IF2A

  • AA Sequence

    SRHQSTLPEDDCTHFPASLPHMLRELRAAFGRVKTFFQMKDKLDNILLTGSLLEDFKSYLGCQALSEMIQFYLEEVMPRAENHDPDIKNHVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVEQVKSAFSKLQEKGVYKAMSEFDIFINYIETYMTMRMKI

  • Predicted Molecular Mass

    18.8 kDa

  • Molecular Weight

    Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00