1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-19 Protein, Mouse

IL-19 Protein, Mouse

Cat. No.: HY-P7213
Handling Instructions

IL-19 Protein, Mouse is a member of the Interleukin-10 family. The biological functions and clinical implications of Interleukin-19 is still undefined.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $420 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

IL-19 Protein, Mouse Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

Q8CJ70 (L25-A176)

Gene ID

329244

Synonyms
rMuIL-19; IL19
AA Sequence

MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA

Molecular Weight

Approximately 17.7 kDa

Biological Activity
The ED50 is <50 ng/mL as measured by MCF-7 cells, corresponding to a specific activity of >2.0 × 104 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 50 mM acetic acid.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

Reconstitute at 50 μg/mL in 50 mM acetic acid.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

IL-19 shares 21% amino acid identity with IL-10. The exon/intron structure of IL-19 is similar to that of the human IL-10 gene, comprising five exons and four introns within the coding region of the IL-19 cDNA. IL-19 does not bind or signal through the canonical IL-10 receptor complex[1]. IL-19 functions through a receptor complex composed of IL-20Ra and IL20Rb that is also utilized by IL-20 and IL-24. IL19 has been shown to enhance the production of Th2 cytokines in Tcells and to be elevated in asthma patients. Furthermore, it induces IL-6, IL-8 and IL-10 expression in monocytes. Additionally, it has been implicated in a range of diseases and disorders, including aging, Type-I diabetes, endotoxic shock, periodontal disease, vascular disease and rheumatoid arthritis[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-19 Protein, Mouse
Cat. No.:
HY-P7213
Quantity:
MCE Japan Authorized Agent: