1. Recombinant Proteins
  2. IL-19 Protein, Human

IL-19 Protein, Human

Cat. No.: HY-P7212
Handling Instructions

IL-19 Protein, Human is a member of the Interleukin-10 family. The biological functions and clinical implications of Interleukin-19 is still undefined.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $210 In-stock
Estimated Time of Arrival: December 31
50 μg $620 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuIL-19; Melanoma differentiation association like protein; ZMDA1
Species

Human

Source

E. coli

Accession

Q9UHD0 (L25-A177)

Gene ID

29949

Molecular Weight

Approximately 17.9 kDa

AA Sequence

LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA

Biological Activity
The ED50 is <1.5 ng/mL as measured by murine BaF3 pro-B cells, corresponding to a specific activity of >6.7 × 105 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

IL-19 shares 21% amino acid identity with IL-10. The exon/intron structure of IL-19 is similar to that of the human IL-10 gene, comprising five exons and four introns within the coding region of the IL-19 cDNA. IL-19 does not bind or signal through the canonical IL-10 receptor complex[1]. IL-19 functions through a receptor complex composed of IL-20Ra and IL20Rb that is also utilized by IL-20 and IL-24. IL19 has been shown to enhance the production of Th2 cytokines in Tcells and to be elevated in asthma patients. Furthermore, it induces IL-6, IL-8 and IL-10 expression in monocytes. Additionally, it has been implicated in a range of diseases and disorders, including aging, Type-I diabetes, endotoxic shock, periodontal disease, vascular disease and rheumatoid arthritis[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-19 Protein, Human
Cat. No.:
HY-P7212
Quantity:
MCE Japan Authorized Agent: