IL-1R1 Protein, Human (HEK293)
Based on 1 Customer Validation
IL-1R1 (CD121a) belongs to IL-1 receptor, and binds to IL-1α, IL-1β, IL-1Ra and IL-38 with comparable affinities (Kd: 0.1-1 nM). IL-1R1 regulates the transcription of multiple proinflammatory cytokines and mediates immune and inflammatory responses, including the activation of NF-κB and MAPK pathway. I IL-1R1 Protein, Human (HEK293) is a recombinant human extracellular region of IL-1R1 (M1-T332) without any tag, which is produced in HEK293 cells.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IL-1R1 (CD121a) belongs to IL-1 receptor, and binds to IL-1α, IL-1β, IL-1Ra and IL-38 with comparable affinities (Kd: 0.1-1 nM)[1]. IL-1R1 regulates the transcription of multiple proinflammatory cytokines and mediates immune and inflammatory responses, including the activation of NF-κB and MAPK pathway[4]. I IL-1R1 Protein, Human (HEK293) is a recombinant human extracellular region of IL-1R1 (M1-T332) without any tag, which is produced in HEK293 cells.
Background
IL-1R1 (CD121a), a member of IL-1 receptor, is a receptor for IL-1α, IL-1β, IL-1Ra and IL-38, thereby mediating IL-1-dependent activation[1]. IL-1R1 is expressed in specific endothelial cells, ventricular cells, astrocytes, and neurons[2].
The sequence of amino acids in IL-1R1 differs in different species. Human IL-1R1 shares <70% aa sequence identity with mouse and rats.
IL-1R1 binds to IL-1 by forming a heterodimer with IL-1R3 (IL-1RAcP). The heterodimer is responsible for the signal transduction by the hydrolysis of GTP, followed by JNK and p38 MAP kinase[3]. Upon binding of IL-1, IL-1R1 initiates the downstream signaling cascade (MAPK p38 and NF-κB pathway)[4]. IL-1R1 signaling induces human Th17 cell differentiation and commitment, which is crucial in the development of autoimmune diseases[4].
IL-1R1 mediates immune and inflammatory responses. IL-1R1 mediates the activation of NF-κB, MAPK pathway.
Verified Bioactivity
Human IL-1 Beta, His Tag captured on CM5 Chip via Anti-his antibody can bind Human IL-1R1, No Tag with an affinity constant of 11.37 nM as determined in SPR assay (Biacore T200).
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P14778/NP_000868.1 (L18-T332)
-
Molecular Construction
-
N-term
-
IL-1R1 (L18-T332)
Accession # P14778 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
IL1R1; IL-1R-Alpha; Prev. IL1RA; Interleukin 1 Receptor Alpha, Type I; Prev. IL1R; Interleukin-1 Receptor, Type I; CD121 Antigen-Like Family Member A; Interleukin 1 Receptor, Type I; Interleukin-1 Receptor Type 1; CD121a Antigen; Interleukin-1 Receptor Ty
-
AA Sequence
LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT
-
Predicted Molecular Mass
36.2 kDa
-
Molecular Weight
Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Diana Boraschi, et al. The family of the interleukin-1 receptors. Immunol Rev. 2018 Jan;281(1):197-232. [Content Brief]
[2]. Daniel P Nemeth, et al. Modulation of Neural Networks by Interleukin-1. Brain Plast. 2021 Aug 23;7(1):17-32. [Content Brief]
[3]. Naoe Kaneko, et al. The role of interleukin-1 in general pathology. Inflamm Regen. 2019 Jun 6;39:12. [Content Brief]
[4]. Yonggang Sha, et al. A role of IL-1R1 signaling in the differentiation of Th17 cells and the development of autoimmune diseases. Self Nonself. 2011 Jan;2(1):35-42. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
