IL-1R1 Protein, Rat (HEK293, His-mFc)

IL-1R1 (CD121a) belongs to IL-1 receptor, and binds to IL-1α, IL-1β, IL-1Ra and IL-38 with comparable affinities (Kd: 0.1-1 nM). IL-1R1 regulates the transcription of multiple proinflammatory cytokines and mediates immune and inflammatory responses, including the activation of NF-κB, MAPK pathways. IL-1R1 Protein, Rat (HEK293, His-mFc) is a recombinant rat extracellular region of IL-1R1 (M1-K352) with C terminal His and hFc tags, which is produced in HEK293 cells.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IL-1R1 (CD121a) belongs to IL-1 receptor, and binds to IL-1α, IL-1β, IL-1Ra and IL-38 with comparable affinities (Kd: 0.1-1 nM). IL-1R1 regulates the transcription of multiple proinflammatory cytokines and mediates immune and inflammatory responses, including the activation of NF-κB, MAPK pathways[1]. IL-1R1 Protein, Rat (HEK293, His-mFc) is a recombinant rat extracellular region of IL-1R1 (M1-K352) with C terminal His and hFc tags, which is produced in HEK293 cells.

Background

IL-1R1 (CD121a), a member of IL-1 receptor, is a receptor for IL-1α, IL-1β, IL-1Ra and IL-38, thereby mediating IL-1-dependent activation[1]. IL-1R1 is mainly expressed in endothelial cells and astrocytes. The neuronal distribution of IL-1R1 is limited in the rat forebrain, and is expressed in the hippocampus, basolateral amygdala and ARH. [2].
The sequence of amino acids in IL-1R1 differs in different species. Rats IL-1R1 shares 85.59% aa sequence identity with mouse, and shares <70% aa sequence identity with Human IL-1R1.
IL-1R1 interacts with IL-1α and IL-1β, thereby promoting signal transduction together with IL-1R3 (IL-1RAcP)[3]. IL-1R1 is important in necrosome formation. IL-1R1 interacts with p-MLKL to trigger neuronal necroptosis after tGCI (global cerebral ischemia)[4].
IL-1R1 mediates necrosome formation, and immune and inflammatory responses including the activation of NF-κB, MAPK and other pathways.

In Vitro

IL-1R1 (murine, .5 μg/mL) prevents the loss of cell-surface IL-1R1 in Il1rn−/− blood cells[6].

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-His;C-mFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-1R1 (L34-K352)
      Accession # A6INN1/NP_037255.3
    • mFc-His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    IL1R1; IL-1R-Alpha; Prev. IL1RA; Interleukin 1 Receptor Alpha, Type I; Prev. IL1R; Interleukin-1 Receptor, Type I; CD121 Antigen-Like Family Member A; Interleukin 1 Receptor, Type I; Interleukin-1 Receptor Type 1; CD121a Antigen; Interleukin-1 Receptor Ty

  • AA Sequence

    LETDKCTEYPNEVISFSSVNEIDIRSCPLTPNEMHGGTIIWYKNDSKTPISADKDSRIHQQNEHLWFVPAKMEDSGYYYCIMRNSTYCLKTKITMSVLENDPGLCYNTQASFIQRLHVAGDGSLVCPYLDFFKDENNELPKVQWYKNCKPLPLDDGNFFGFKNKLMVMNVAEEHRGNYTCRTSYTYQGKQYPVTRVITFITIDDSKRDRPVIMSPRNETMEADPGSTIQLICNVTGQFTDLVYWKWNGSEIEWDDPILAEDYQFLEHPSAKRKYTLITTLNVSEVKSQFYRYPFICFVKNTHILETAHVRLVYPVPDFK

  • Predicted Molecular Mass

    64.6 kDa

  • Molecular Weight

    Approximately 90-95 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00