IL-33 Protein, Human (His)
Based on 1 publication(s) in Google Scholar
IL-33 protein, as a cytokine, binds to and signals through the IL1RL1/ST2 receptor, thereby activating the NF-kappa-B and MAPK signaling pathways in target cells. It is involved in the maturation of Th2 cells and contributes to the secretion of T helper cell type 2 related cytokines. IL-33 Protein, Human (His) is the recombinant human-derived IL-33 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
IL-33 protein, as a cytokine, binds to and signals through the IL1RL1/ST2 receptor, thereby activating the NF-kappa-B and MAPK signaling pathways in target cells. It is involved in the maturation of Th2 cells and contributes to the secretion of T helper cell type 2 related cytokines. IL-33 Protein, Human (His) is the recombinant human-derived IL-33 protein, expressed by E. coli , with N-6*His labeled tag.
IL-33 protein, functioning as a cytokine, binds to and signals through the IL1RL1/ST2 receptor, thereby activating the NF-kappa-B and MAPK signaling pathways in target cells. Its involvement in the maturation of Th2 cells contributes to the secretion of T-helper type 2-associated cytokines. Additionally, IL-33 plays a crucial role in the activation of mast cells, basophils, eosinophils, and natural killer cells. Acting as an enhancer of the polarization of alternatively activated macrophages, it serves as a chemoattractant for Th2 cells and may function as an 'alarmin,' amplifying immune responses during tissue injury. IL-33 induces rapid UCP2-dependent mitochondrial rewiring, mitigating the generation of reactive oxygen species and preserving the integrity of the Krebs cycle, which is essential for the persistent production of itaconate and subsequent GATA3-dependent differentiation of inflammation-resolving alternatively activated macrophages. In quiescent endothelia, the uncleaved form of IL-33 is constitutively and abundantly expressed, acting as a chromatin-associated nuclear factor with transcriptional repressor properties, potentially sequestering nuclear NF-kappaB/RELA and thereby lowering the expression of its targets; this form is rapidly lost upon angiogenic or pro-inflammatory activation.
1. Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is 0.4463 ng/mL, corresponding to a specific activity is 2.254×106 units/mg.
2. Loaded Etokimab (HY-P99018) on AHC2 biosensor, can bind IL-33 Protein, Human (His) with an affinity constant of 8.643E-11 M as determined in BLI assay.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Imeta
Single-cell sequencing reveals the role of IL-33 + endothelial subsets in promoting early gastric cancer progression. [Abstract]2025 Jun 5;4(4):e70050. PMID: 40860436
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
O95760-1 (S112-T270)
-
Molecular Construction
-
N-term
-
6*His
-
IL-33 (S112-T270)
Accession # O95760-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
IL33; DVS27-Related Protein; Prev. C9orf26; Chromosome 9 Open Reading Frame 26 (NF-HEV); NF-HEV; Interleukin-1 Family, Member 11; IL1F11; Alternative Protein IL33; Interleukin-33; IL-1F11; DVS27; NFEHEV; Nuclear Factor From High Endothelial Venules; IL-33
-
AA Sequence
SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
-
Molecular Weight
Approximately 21 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)