TSLP Protein, Human (HEK293, His)

TSLP Protein, a cytokine, stimulates T-cell-attracting chemokine release from monocytes and enhances CD11c(+) dendritic cell maturation. It directly activates mast cells, possibly inducing allergic inflammation. TSLP may also possess antimicrobial properties in the oral cavity and on the skin. TSLP Protein, Human (HEK293, His) is the recombinant human-derived TSLP protein, expressed by HEK293 , with C-10*His labeled tag.

The TSLP protein is a cytokine that stimulates the release of T-cell-attracting chemokines from monocytes, with a particular effect on enhancing the maturation of CD11c(+) dendritic cells. Additionally, this protein can directly activate mast cells, potentially leading to the induction of allergic inflammation. It is also suggested that TSLP may have antimicrobial properties in the oral cavity and on the skin.

1. Immobilized Anti-Human TSLP mAb at 2 μg/mL (100 μL/well) can bind Human TSLP-His. The ED₅₀ of Recombinant Human TSLP-His is ≤5.6 ng/mL. 
2. Measured by its binding ability in a functional ELISA. Immobilized Human TSLP at 5 μg/mL (100μl/well) on the plate can bind Human TSLPR. The ED₅₀ for this effect is 23.29 ng/mL.
3. Loaded Bosakitug (HY-P990906) on AHC2 biosensor, can bind TSLP Protein, Human (HEK293, His) with an affinity constant of 4.639E-10 M as determined in BLI assay.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Human TSLP at 5 μg/mL (100 μL/well) on the plate can bind Human TSLPR. The ED₅₀ for this effect is 23.29 ng/mL.
• 
  Loaded Bosakitug (HY-P990906) on AHC2 biosensor, can bind TSLP Protein, Human (HEK293, His) with an affinity constant of 4.639E-10 M as determined in BLI assay.
• 
  Loaded Tilrekimig (HY-P991162) on ProA biosensor, can bind TSLP Protein, Human (HEK293, His) with an affinity constant of 1.060E-09 M as determined in BLI assay.
• 
  Loaded TSLP Protein, Human (HEK293, His) on HIS1K biosensor, can bind Lunsekimig (HY-P990748) with an affinity constant of <1.0E-11 M as determined in BLI assay.

Human

HEK293

C-10*His

Q969D9-1 (Y29-Q159)

85480  [NCBI]

Full Length of Isoform-1 Mature Protein

YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Approximately 8-10 kDa & 16-27 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.