Copy Link Print Information

TSLP Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

TSLP Protein, a cytokine, stimulates T-cell-attracting chemokine release from monocytes and enhances CD11c(+) dendritic cell maturation. It directly activates mast cells, possibly inducing allergic inflammation. TSLP may also possess antimicrobial properties in the oral cavity and on the skin. TSLP Protein, Human (HEK293, His) is the recombinant human-derived TSLP protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for TSLP Protein, Human (HEK293, His)
  • Experimental Validation Results for TSLP Protein, Human (HEK293, His)
  • Experimental Validation Results for TSLP Protein, Human (HEK293, His)
  • Experimental Validation Results for TSLP Protein, Human (HEK293, His)
  • Experimental Validation Results for TSLP Protein, Human (HEK293, His)
  • TSLP Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TSLP Protein, a cytokine, stimulates T-cell-attracting chemokine release from monocytes and enhances CD11c(+) dendritic cell maturation. It directly activates mast cells, possibly inducing allergic inflammation. TSLP may also possess antimicrobial properties in the oral cavity and on the skin. TSLP Protein, Human (HEK293, His) is the recombinant human-derived TSLP protein, expressed by HEK293 , with C-10*His labeled tag.

Background

The TSLP protein is a cytokine that stimulates the release of T-cell-attracting chemokines from monocytes, with a particular effect on enhancing the maturation of CD11c(+) dendritic cells. Additionally, this protein can directly activate mast cells, potentially leading to the induction of allergic inflammation. It is also suggested that TSLP may have antimicrobial properties in the oral cavity and on the skin.

Verified Bioactivity

1. Immobilized Anti-Human TSLP mAb at 2 μg/mL (100 μL/well) can bind Human TSLP-His. The ED50 of Recombinant Human TSLP-His is ≤5.6 ng/mL. 
2. Measured by its binding ability in a functional ELISA. Immobilized Human TSLP at 5 μg/mL (100μl/well) on the plate can bind Human TSLPR. The ED50 for this effect is 23.29 ng/mL.
3. Loaded Bosakitug (HY-P990906) on AHC2 biosensor, can bind TSLP Protein, Human (HEK293, His) with an affinity constant of 4.639E-10 M as determined in BLI assay.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Human TSLP at 5 μg/mL (100 μL/well) on the plate can bind Human TSLPR. The ED50 for this effect is 23.29 ng/mL.

  • Bioactivity - BLI

    Bioactivity - BLI

    Loaded Bosakitug (HY-P990906) on AHC2 biosensor, can bind TSLP Protein, Human (HEK293, His) with an affinity constant of 4.639E-10 M as determined in BLI assay.

  • Bioactivity - BLI

    Bioactivity - BLI

    Loaded Tilrekimig (HY-P991162) on ProA biosensor, can bind TSLP Protein, Human (HEK293, His) with an affinity constant of 1.060E-09 M as determined in BLI assay.

  • Bioactivity - BLI

    Bioactivity - BLI

    Loaded TSLP Protein, Human (HEK293, His) on HIS1K biosensor, can bind Lunsekimig (HY-P990748) with an affinity constant of <1.0E-11 M as determined in BLI assay.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-10*His
  • Accession

    Q969D9-1 (Y29-Q159)

  • Gene ID
    85480  [NCBI]
  • Molecular Construction
    • N-term
    • TSLP (Y29-Q159)
      Accession # Q969D9-1
    • 10*His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    Thymic Stroma-Derived Lymphopoietin; Thymic Stromal Lymphopoietin; TSLP

  • AA Sequence

    YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

  • Predicted Molecular Mass

    16.3 kDa

  • Molecular Weight

    Approximately 8-10 kDa & 16-27 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Human TSLP at 5 μg/mL (100 μL/well) on the plate can bind Human TSLPR. The ED50 for this effect is 23.29 ng/mL.

  • 1/16

    MedChemExpress Validation
     Loaded Bosakitug (HY-P990906) on AHC2 biosensor, can bind TSLP Protein, Human (HEK293, His) with an affinity constant of 4.639E-10 M as determined in BLI assay.

  • 1/16

    MedChemExpress Validation
     Loaded Tilrekimig (HY-P991162) on ProA biosensor, can bind TSLP Protein, Human (HEK293, His) with an affinity constant of 1.060E-09 M as determined in BLI assay.

  • 1/16

    MedChemExpress Validation
     Loaded TSLP Protein, Human (HEK293, His) on HIS1K biosensor, can bind Lunsekimig (HY-P990748) with an affinity constant of <1.0E-11 M as determined in BLI assay.

  • TSLP Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for TSLP Protein, Human (HEK293, His)
  • Experimental Validation Results for TSLP Protein, Human (HEK293, His)
  • Experimental Validation Results for TSLP Protein, Human (HEK293, His)
  • Experimental Validation Results for TSLP Protein, Human (HEK293, His)
  • Experimental Validation Results for TSLP Protein, Human (HEK293, His)
  • TSLP Protein, Human (HEK293, His) Product Image