TSLP Receptor Protein, Human (HEK293, His)
Based on 1 Customer Validation
TSLP Receptor Protein, a receptor for TSLP, forms a functional complex with IL7R, activating STAT3 and STAT5 for cell proliferation. It also activates JAK2, aiding in hematopoietic system development. TSLP Receptor forms a heterodimer with CRLF2 and IL7R, highlighting its role in intricate signaling pathways crucial for cellular responses and hematopoietic development. TSLP Receptor Protein, Human (HEK293, His) is the recombinant human-derived TSLP Receptor protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TSLP Receptor Protein, a receptor for TSLP, forms a functional complex with IL7R, activating STAT3 and STAT5 for cell proliferation. It also activates JAK2, aiding in hematopoietic system development. TSLP Receptor forms a heterodimer with CRLF2 and IL7R, highlighting its role in intricate signaling pathways crucial for cellular responses and hematopoietic development. TSLP Receptor Protein, Human (HEK293, His) is the recombinant human-derived TSLP Receptor protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The TSLP Receptor Protein serves as the receptor for thymic stromal lymphopoietin (TSLP) and, in conjunction with IL7R, forms a functional complex capable of stimulating cell proliferation through the activation of STAT3 and STAT5. Additionally, the receptor activates JAK2, contributing to the development of the hematopoietic system. The TSLP Receptor Protein forms a heterodimer with CRLF2 and IL7R, indicating its involvement in intricate signaling pathways critical for cellular responses and hematopoietic development.
Verified Bioactivity
1.Loaded Verekitug (HY-P990774) on AHC2 biosensor, can bind TSLP R Protein, Human (HEK293, His) with an affinity constant of 1.847×10-10 M as determined in BLI assay.
2.Immobilized Human TSLP R-His at 2 μg/ml (100 μl/well) can bind Human TSLP-Fc. The ED50 of Human TSLP RHis is 1.32-3.67 ng/ml.
MCE Validation Data
-
Bioactivity - BLI
Bioactivity - BLI
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9HC73 (G25-K231)
-
Molecular Construction
-
N-term
-
TSLP R (G25-K231)
Accession # Q9HC73 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CRLF2; IL-XR; Cytokine Receptor Like Factor 2; Thymic Stromal-Derived Lymphopoietin Receptor; TSLPR; Cytokine Receptor CRL2 Precusor; CRL2; Cytokine Receptor-Like 2; Thymic Stromal Lymphopoietin Protein Receptor; CRLF2Y; Cytokine Receptor-Like Factor 2; P
-
AA Sequence
GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK
-
Predicted Molecular Mass
24.8 kDa
-
Molecular Weight
Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
