IRF9 Protein, Human (His, Strep)
IRF9 Protein, Human (His, Strep) is the recombinant human-derived IRF9, expressed by E. coli , with Strep, His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
IRF9 Protein, Human (His, Strep) is the recombinant human-derived IRF9, expressed by E. coli , with Strep, His labeled tag. ,
Background
IRF9 is a transcription factor that plays a crucial role in antiviral immunity. It mediates signaling through type I interferons (IFN-alpha and IFN-beta). Upon binding of type I IFNs to cell surface receptors, Jak kinases (TYK2 and JAK1) are activated, leading to tyrosine phosphorylation of STAT1 and STAT2. IRF9/ISGF3G then associates with the phosphorylated STAT1:STAT2 dimer to form the ISGF3 transcription factor complex, which translocates into the nucleus. ISGF3 binds to the interferon-stimulated response element (ISRE) to activate the transcription of interferon-stimulated genes, thereby driving the cell into an antiviral state.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
Q00978 (M1-V393)
-
Gene ID10379
-
Protein Length
Full Length
-
Synonyms
IRF9; Interferon-Stimulated Transcription Factor 3, Gamma (48kD); Prev. ISGF3G; ISGF-3 Gamma; IFN-Alpha-Responsive Transcription Factor Subunit; IRF-9; Transcriptional Regulator ISGF3 Subunit Gamma; ISGF3; Interferon-Stimulated Gene Factor 3 Gamma; P48; I
-
AA Sequence
MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLV
-
Predicted Molecular Mass
46.9 kDa
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)