IRF9 Protein, Human (sf9, His, Strep)

IRF9 Protein, Human (sf9, His, Strep) is the recombinant human-derived IRF9 protein, expressed by Sf9 insect cells, with Strep & His tag.

IRF9 is a transcription factor that plays a crucial role in antiviral immunity. It mediates signaling through type I interferons (IFN-alpha and IFN-beta). Upon binding of type I IFNs to cell surface receptors, Jak kinases (TYK2 and JAK1) are activated, leading to tyrosine phosphorylation of STAT1 and STAT2. IRF9/ISGF3G then associates with the phosphorylated STAT1:STAT2 dimer to form the ISGF3 transcription factor complex, which translocates into the nucleus. ISGF3 binds to the interferon-stimulated response element (ISRE) to activate the transcription of interferon-stimulated genes, thereby driving the cell into an antiviral state.

Human

Sf9 insect cells

Strep;His

Q00978 (M1-V393)

10379

Full Length

MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLV

Approximately 47 KDa

≥ 95%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.