JAK1 Protein, Human (Inactive, sf9, His)

Customer Review

Based on 1 Customer Validation

JAK1 protein is a non-receptor tyrosine kinase that plays a crucial role in IFN-α/β/γ signaling and serves as a kinase partner for IL-2 and IL-10 receptors. It cooperates with the type I interferon receptor IFNAR2 to phosphorylate and activate IFNAR2 upon interferon binding to IFNAR1-IFNAR2. JAK1 Protein, Human (Inactive, sf9, His) is the recombinant human-derived JAK1 protein, expressed by sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

JAK1 protein is a non-receptor tyrosine kinase that plays a crucial role in IFN-α/β/γ signaling and serves as a kinase partner for IL-2 and IL-10 receptors. It cooperates with the type I interferon receptor IFNAR2 to phosphorylate and activate IFNAR2 upon interferon binding to IFNAR1-IFNAR2. JAK1 Protein, Human (Inactive, sf9, His) is the recombinant human-derived JAK1 protein, expressed by sf9 insect cells , with N-His labeled tag.

Background

JAK1 protein, a non-receptor tyrosine kinase, plays a crucial role in the IFN-alpha/beta/gamma signal pathway, as evidenced by various studies. It acts as a kinase partner for the interleukin (IL)-2 receptor and IL-10 receptor, demonstrating its versatility in different cytokine signaling pathways. Moreover, JAK1 serves as a kinase partner for the type I interferon receptor IFNAR2, and upon interferon binding to the IFNAR1-IFNAR2 heterodimer, it phosphorylates and activates IFNAR2, creating docking sites for STAT proteins. JAK1 not only directly phosphorylates STAT proteins but also activates STAT signaling by transactivating other JAK kinases associated with signaling receptors. This multifaceted involvement positions JAK1 as a central player in the intricate network of signaling pathways, contributing to the regulation of immune responses and cellular processes.

Verified Bioactivity

The JH2 domain is a conserved pseudokinase domain in JAK family kinases that lacks catalytic activity but plays a regulatory role.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source sf9 insect cells
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • JAK1 (A561-N852)
      Accession # P23458
    • C-term
  • Protein Length

    Partial

  • Synonyms

    JAK1; JTK3; Prev. JAK1B; JAK1 Protein; JAK1A; AIIDE; Tyrosine-Protein Kinase JAK1; JAK-1; Janus Kinase 1; Tyrosine-Protein Kinase

  • AA Sequence

    AQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSGTLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGTTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEEQN

  • Molecular Weight

    Approximately 30-33 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 500 mM NaCl, pH 8.0, 2 mM TCEP, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00