JAK1 Protein, Human (Inactive, sf9, His)
Based on 1 Customer Validation
JAK1 protein is a non-receptor tyrosine kinase that plays a crucial role in IFN-α/β/γ signaling and serves as a kinase partner for IL-2 and IL-10 receptors. It cooperates with the type I interferon receptor IFNAR2 to phosphorylate and activate IFNAR2 upon interferon binding to IFNAR1-IFNAR2. JAK1 Protein, Human (Inactive, sf9, His) is the recombinant human-derived JAK1 protein, expressed by sf9 insect cells , with N-His labeled tag.
- Species: Human
- Source: sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
JAK1 protein is a non-receptor tyrosine kinase that plays a crucial role in IFN-α/β/γ signaling and serves as a kinase partner for IL-2 and IL-10 receptors. It cooperates with the type I interferon receptor IFNAR2 to phosphorylate and activate IFNAR2 upon interferon binding to IFNAR1-IFNAR2. JAK1 Protein, Human (Inactive, sf9, His) is the recombinant human-derived JAK1 protein, expressed by sf9 insect cells , with N-His labeled tag.
Background
JAK1 protein, a non-receptor tyrosine kinase, plays a crucial role in the IFN-alpha/beta/gamma signal pathway, as evidenced by various studies. It acts as a kinase partner for the interleukin (IL)-2 receptor and IL-10 receptor, demonstrating its versatility in different cytokine signaling pathways. Moreover, JAK1 serves as a kinase partner for the type I interferon receptor IFNAR2, and upon interferon binding to the IFNAR1-IFNAR2 heterodimer, it phosphorylates and activates IFNAR2, creating docking sites for STAT proteins. JAK1 not only directly phosphorylates STAT proteins but also activates STAT signaling by transactivating other JAK kinases associated with signaling receptors. This multifaceted involvement positions JAK1 as a central player in the intricate network of signaling pathways, contributing to the regulation of immune responses and cellular processes.
Verified Bioactivity
The JH2 domain is a conserved pseudokinase domain in JAK family kinases that lacks catalytic activity but plays a regulatory role.
Technical Parameters
-
Species Human
-
Source sf9 insect cells
-
Tag N-6*His
-
Accession
P23458 (A561-N852)
-
Molecular Construction
-
N-term
-
His
-
JAK1 (A561-N852)
Accession # P23458 -
C-term
-
-
Protein Length
Partial
-
Synonyms
JAK1; JTK3; Prev. JAK1B; JAK1 Protein; JAK1A; AIIDE; Tyrosine-Protein Kinase JAK1; JAK-1; Janus Kinase 1; Tyrosine-Protein Kinase
-
AA Sequence
AQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSGTLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGTTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEEQN
-
Molecular Weight
Approximately 30-33 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 500 mM NaCl, pH 8.0, 2 mM TCEP, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
