JAK3 Protein, Human (Active, sf9, GST)

JAK3 Protein, Human (sf9, GST) is the recombinant human-derived JAK3, expressed by Sf9 insect cells , with GST labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

JAK3 Protein, Human (sf9, GST) is the recombinant human-derived JAK3, expressed by Sf9 insect cells , with GST labeled tag. ,

Background

JAK3 is a non-receptor tyrosine kinase involved in various processes such as cell growth, development, or differentiation. It mediates essential signaling events in both innate and adaptive immunity and plays a crucial role in hematopoiesis during T-cell development. In the cytoplasm, JAK3 plays a pivotal role in signal transduction by associating with type I receptors that share the common γ subunit, such as IL2R, IL4R, IL7R, IL9R, IL15R, and IL21R. Following ligand binding to cell surface receptors, JAK3 phosphorylates specific tyrosine residues on the cytoplasmic tails of the receptor, creating docking sites for STATs proteins. It then phosphorylates the recruited STATs proteins, which subsequently form homodimers or heterodimers and translocate to the nucleus to activate gene transcription. For example, upon IL2 binding to IL2R, JAK1 and JAK3 bind to the IL2R β (IL2RB) and γ (IL2RG) subunits, inducing tyrosine phosphorylation of both receptor subunits. STAT5A and STAT5B are then recruited, phosphorylated, and activated by JAK1 and JAK3. The activated, dimerized STAT5 translocates to the nucleus to promote transcription of specific target genes in a cytokine-specific manner.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-GST
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    JAK3; JAK3_HUMAN; Janus Kinase 3; JAKL; L-JAK; LJAK; JAK-3; Janus Kinase 3 (A Protein Tyrosine Kinase, Leukocyte); Tyrosine-Protein Kinase JAK3; Tyrosine-Protein Kinase; Leukocyte Janus Kinase

  • AA Sequence

    ISSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGCERDVPALCRLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALGPQLDMLWSGSRGCETHAFTAHPEGKHHSLSFS

  • Molecular Weight

    Approximately 64 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00