1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. LD78-beta/CCL3L1 Protein, Human

LD78-beta/CCL3L1 Protein, Human

Cat. No.: HY-P7231
COA Handling Instructions

LD78-beta/CCL3L1 Protein, Human is a potent ligand for the HIV-1 co-receptor CCR5, which is essential for viral entry into human host cells.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $160 In-stock
Estimated Time of Arrival: December 31
50 μg $390 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

LD78-beta/CCL3L1 Protein, Human is a potent ligand for the HIV-1 co-receptor CCR5, which is essential for viral entry into human host cells.

Background

CCL3L1 is the most potent known ligand for CC chemokine receptor 5 (CCR5), the major coreceptor for HIV, and it is a dominant HIV-suppressive chemokine. Possession of a CCL3L1 copy number lower than the population average is associated with markedly enhanced HIV/acquired immunodeficiency syndrome (AIDS) susceptibility[1].

Biological Activity
The ED50 is <0.4 μg/mL as measured by CHO cells, corresponding to a specific activity of >2.5 × 103 units/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P16619 (A24-A93)

Gene ID

6349  [NCBI]

Synonyms
rHuLD78β/CCL3L1; C-C motif chemokine 3-like 1; SCYA3L1
AA Sequence

APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA

Molecular Weight

Approximately 7.8 kDa

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

LD78-beta/CCL3L1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LD78-beta/CCL3L1 Protein, Human
Cat. No.:
HY-P7231
Quantity:
MCE Japan Authorized Agent: