Copy Link Print Information

LRP-10 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, His) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for LRP-10 Protein, Human (HEK293, His)
  • Experimental Validation Results for LRP-10 Protein, Human (HEK293, His)
  • LRP-10 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, His) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-His labeled tag.

Background

The LRP-10 protein emerges as a probable receptor with potential involvement in the internalization of lipophilic molecules and/or signal transduction. This receptor is speculated to play a role in the uptake of lipoprotein APOE in the liver, suggesting a function in lipid metabolism and cellular processes related to lipoprotein transport. The precise mechanisms and signaling pathways associated with LRP-10 in mediating the internalization of lipophilic molecules warrant further investigation to comprehensively understand its role in cellular uptake and potential contributions to lipid homeostasis.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human LRPAP (HY-P76478A) at 5 μg/mL can bind Biotinylated Human LRP-10. The ED50 for this effect is 13.34 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Human LRPAP (HY-P76478A) at 5 μg/mL can bind Biotinylated Human LRP-10. The ED50 for this effect is 13.34 μg/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-10*His
  • Accession

    Q7Z4F1-1 (H17-K440)

  • Gene ID
    26020  [NCBI]
  • Molecular Construction
    • N-term
    • LRP-10 (H17-K440)
      Accession # Q7Z4F1-1
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    LRP10; DKFZP564C1940; LDL Receptor Related Protein 10; MGC8675; MSTP087; LRP-10; MST087; Low Density Lipoprotein Receptor-Related Protein 10; LRP9; LRP10 Protein; Low-Density Lipoprotein Receptor-Related Protein 10

  • AA Sequence

    HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK

  • Molecular Weight

    Approximately 55 kDa

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Human LRPAP (HY-P76478A) at 5 μg/mL can bind Biotinylated Human LRP-10. The ED50 for this effect is 13.34 μg/mL.

  • LRP-10 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for LRP-10 Protein, Human (HEK293, His)
  • Experimental Validation Results for LRP-10 Protein, Human (HEK293, His)
  • LRP-10 Protein, Human (HEK293, His) Product Image