1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. MCP-1/CCL2
  6. MCP-1/CCL2 Protein, Mouse (HEK293)

MCP-1/CCL2 Protein, Mouse (HEK293) is a cytokine belonging to the CC chemokine family that interacts with the CCR2 chemokine receptor on the cell surface to mediate inflammatory immune responses, viral infections, and tumorigenesis. MCP-1/CCL2 Protein, Mouse (HEK293) is a mouse MCP-1/CCL2 (Q24-R96) expressed by HEK293.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

MCP-1/CCL2 Protein, Mouse (HEK293) is a cytokine belonging to the CC chemokine family that interacts with the CCR2 chemokine receptor on the cell surface to mediate inflammatory immune responses, viral infections, and tumorigenesis. MCP-1/CCL2 Protein, Mouse (HEK293) is a mouse MCP-1/CCL2 (Q24-R96) expressed by HEK293[1].

Background

CCL2, also known as monocyte chemotactic protein 1 (MCP1), is a small cell factor belonging to the CC chemokine family. The CCL2 gene, located in the q11.2-q12 region of human chromosome 17, encodes a monomeric polypeptide with a molecular weight of 9-15 kDa, depending on the level of glycosylation. CCL2 is mainly secreted by monocytes, macrophages and dendritic cells. It is secreted by monocytes, macrophages and dendritic cells, and platelet-derived growth factor is the main inducer of the CCL2 gene. Astrocytes and microglia are also thought to be the source of CCL2[1]. CCL2 signals through binding to and activation of CCR2 and induces a strong chemotactic response and intracellular mobilization of calcium ions. Among other things, CCL2/CCR2 can regulate cell adhesion and chemotaxis of macrophages by activating the β1 integrin and p38-MAPK signaling pathways. In addition to acting as a chemoattractant, CCL2 can also regulate brain endothelial permeability in vitro by altering tight junction (TJ) proteins and regulating the expression of endothelial adhesion molecules and leukocyte integrins as well as cytokine production. In addition, the CCL2-CCR2 signaling axis has been implicated in many inflammatory and neurodegenerative diseases, acting to recruit inflammatory cells into the CNS[2].  Originally described as a "tumor-derived chemokine", CCL2 has been shown to be a potent chemokine for many types of immune cells and a potential target for the treatment of many diseases, such as atherosclerosis, multiple sclerosis, asthma, neuropathic pain, diabetic nephropathy, and cancer[3].

In Vitro

MCP-1/CCL2 (100 ng/mL, 24 h) can induce NO production by co-treatment with IFN-γ, increases ERK phosphorylation and increases iNOS expression, suggesting that the mechanism of NO production is related to the ERK1/2 signaling pathway in peritoneal macrophages of mice, thereby increasing bacterial clearance[3].
 CCL2 (0.05 ng/μL) promotes α-synuclein secretion and α-synuclein-induced neuronal apoptosis, and induces microglia proliferation and secretion of TNF-α, IL-1β and NO[4].

In Vivo

MCP-1/CCL2 (intracerebral injection, 5-25 μg, 1 μL/h for 3 days or 0.5 μL/h for 7 days) induces FITC-albumin leakage at lower concentrations (5-20 μg) but fails or moderately induces leukocyte infiltration. Blood-brain barrier permeability and leukocyte infiltration are significantly increased at 25 μg, and extravasation is significantly enhanced in the treated CD-1 mice compared with the control group 6 h after injection. Prolonged administration for 3 or 7 days results in a significant increase in the percentage of brain water content, and decreases expression of the tight junction proteins occludin, claudin-5, ZO-1 and ZO-2[2].

Biological Activity

1. The ED50 is <0.3 μg/mL as measured by CHO-K1/Gα15/mCCR2 cells (human Gα15 and mouse CCR2 stably expressed in CHO-K1 cells).
2. Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 this effect is <26.8 ng/mL, corresponding to a specific activity is >3.733×10^4 U/mg.

  • Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 26.79 ng/mL, corresponding to a specific activity is 3.733×104 U/mg.
Species

Mouse

Source

HEK293

Tag

Tag Free

Accession

P10148 (Q24-R96)

Gene ID
Molecular Construction
N-term
CCL2 (Q24-R96)
Accession # P10148
C-term
Protein Length

Partial

Synonyms
rMuMCP-1/CCL2; C-C motif chemokine 2; MCAF; MCP-1; SCYA2
AA Sequence

QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR

Predicted Molecular Mass
8.5 kDa
Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

MCP-1/CCL2 Protein, Mouse (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MCP-1/CCL2 Protein, Mouse (HEK293)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MCP-1/CCL2 Protein, Mouse (HEK293)
Cat. No.:
HY-P7235
Quantity:
MCE Japan Authorized Agent: