MTCP1 Protein, Human

The MTCP1 protein plays a crucial role in promoting the phosphorylation and activation of AKT1 and AKT2, two key members of the AKT family. It does this through specific interactions with AKT1 and AKT2, primarily through their PH (pleckstrin homology) domains. MTCP1 Protein, Human is the recombinant human-derived MTCP1 protein, expressed by E. coli , with tag free.

MTCP1 protein plays a crucial role in promoting the phosphorylation and activation of AKT1 and AKT2, two key members of the AKT family. It accomplishes this through specific interactions with both AKT1 and AKT2, primarily through their PH (pleckstrin homology) domains. Interestingly, MTCP1 does not exhibit any interaction with AKT3, indicating a selective binding preference. By facilitating the activation of AKT1 and AKT2, MTCP1 contributes to the regulation of numerous cellular processes, including cell growth, survival, and metabolism. Understanding the specific molecular interactions between MTCP1 and AKT1/2 can provide valuable insights into the intricate mechanisms controlling AKT signaling and its downstream effects on cellular physiology.

Human

E. coli

Tag Free

P56278 (M1-D107)

4515

Full Length

MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.