1. Recombinant Proteins
  2. Others
  3. MTCP1 Protein, Human

The MTCP1 protein plays a crucial role in promoting the phosphorylation and activation of AKT1 and AKT2, two key members of the AKT family. It does this through specific interactions with AKT1 and AKT2, primarily through their PH (pleckstrin homology) domains. MTCP1 Protein, Human is the recombinant human-derived MTCP1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MTCP1 protein plays a crucial role in promoting the phosphorylation and activation of AKT1 and AKT2, two key members of the AKT family. It does this through specific interactions with AKT1 and AKT2, primarily through their PH (pleckstrin homology) domains. MTCP1 Protein, Human is the recombinant human-derived MTCP1 protein, expressed by E. coli , with tag free.

Background

MTCP1 protein plays a crucial role in promoting the phosphorylation and activation of AKT1 and AKT2, two key members of the AKT family. It accomplishes this through specific interactions with both AKT1 and AKT2, primarily through their PH (pleckstrin homology) domains. Interestingly, MTCP1 does not exhibit any interaction with AKT3, indicating a selective binding preference. By facilitating the activation of AKT1 and AKT2, MTCP1 contributes to the regulation of numerous cellular processes, including cell growth, survival, and metabolism. Understanding the specific molecular interactions between MTCP1 and AKT1/2 can provide valuable insights into the intricate mechanisms controlling AKT signaling and its downstream effects on cellular physiology.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P56278 (M1-D107)

Gene ID

4515

Molecular Construction
N-term
MTCP1 (M1-D107)
Accession # P56278
C-term
Protein Length

Full Length

Synonyms
MTCP1; Protein p13 MTCP-1; p13MTCP1; Mature T-cell proliferation-1 type B1; MTCP-1 type B1
AA Sequence

MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

MTCP1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MTCP1 Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MTCP1 Protein, Human
Cat. No.:
HY-P701856
Quantity:
MCE Japan Authorized Agent: