MTCP1 Protein, Human
The MTCP1 protein plays a crucial role in promoting the phosphorylation and activation of AKT1 and AKT2, two key members of the AKT family. It does this through specific interactions with AKT1 and AKT2, primarily through their PH (pleckstrin homology) domains. MTCP1 Protein, Human is the recombinant human-derived MTCP1 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The MTCP1 protein plays a crucial role in promoting the phosphorylation and activation of AKT1 and AKT2, two key members of the AKT family. It does this through specific interactions with AKT1 and AKT2, primarily through their PH (pleckstrin homology) domains. MTCP1 Protein, Human is the recombinant human-derived MTCP1 protein, expressed by E. coli , with tag free.
Background
MTCP1 protein plays a crucial role in promoting the phosphorylation and activation of AKT1 and AKT2, two key members of the AKT family. It accomplishes this through specific interactions with both AKT1 and AKT2, primarily through their PH (pleckstrin homology) domains. Interestingly, MTCP1 does not exhibit any interaction with AKT3, indicating a selective binding preference. By facilitating the activation of AKT1 and AKT2, MTCP1 contributes to the regulation of numerous cellular processes, including cell growth, survival, and metabolism. Understanding the specific molecular interactions between MTCP1 and AKT1/2 can provide valuable insights into the intricate mechanisms controlling AKT signaling and its downstream effects on cellular physiology.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P56278 (M1-D107)
-
Gene ID4515
-
Molecular Construction
-
N-term
-
MTCP1 (M1-D107)
Accession # P56278 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
MTCP1; TCL1 Family AKT Coactivator C; Mature T Cell Proliferation 1; Protein P13 MTCP-1; P13MTCP1; MTCP-1 Type B1; P8MTCP1; Mature T-Cell Proliferation 1; TCL1C; C6.1B; Mature T-Cell Proliferation-1 Type B1
-
AA Sequence
MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)