NPY Protein, Human (HEK293, His)
Based on 2 publication(s) in Google Scholar
NPY protein is related to feeding behavior and GnRH secretion, and plays a crucial role in complex neural circuits that control appetite and energy balance. Its effects on GnRH secretion suggest a multifaceted role in the interplay between neural and endocrine pathways, particularly during reproduction. NPY Protein, Human (HEK293, His) is the recombinant human-derived NPY protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
NPY protein is related to feeding behavior and GnRH secretion, and plays a crucial role in complex neural circuits that control appetite and energy balance. Its effects on GnRH secretion suggest a multifaceted role in the interplay between neural and endocrine pathways, particularly during reproduction. NPY Protein, Human (HEK293, His) is the recombinant human-derived NPY protein, expressed by HEK293 , with C-6*His labeled tag.
Background
NPY Protein is implicated in the regulation of feeding behavior and the secretion of gonadotrophin-releasing hormone (GnRH). Its involvement in the control of feeding suggests a key role in the complex neural circuits that modulate appetite and energy balance. Additionally, NPY's influence on GnRH secretion underscores its potential impact on reproductive processes, highlighting its multifaceted role in the intricate interplay between neural and endocrine pathways. Further research is essential to fully elucidate the molecular mechanisms through which NPY exerts its effects on feeding control and GnRH secretion, providing insights into its broader physiological functions.
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Adv Sci (Weinh)
2021 Dec;8(24):e2100808. PMID: 34719888 -
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P01303 (Y29-W97)
-
Molecular Construction
-
N-term
-
NPY (Y29-W97)
Accession # P01303 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
NPY; Prepro-Neuropeptide Y; Neuropeptide Y; Pro-Neuropeptide Y; PYY4
-
AA Sequence
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW
-
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
