1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins CMGC
  4. MAPK Family MAPK
  5. p38b/MAPK11
  6. P38β Protein, Human (Inactive, sf9)

The P38β protein is an important serine/threonine kinase in the MAP kinase pathway that responds to extracellular stimuli, including proinflammatory cytokines and physical stress. As part of the p38 MAPK family, P38β directly activates transcription factors that phosphorylate many proteins, including RPS6KA5/MSK1 and RPS6KA4/MSK2. P38β Protein, Human (sf9) is the recombinant human-derived P38β protein, expressed by sf9 insect cells , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The P38β protein is an important serine/threonine kinase in the MAP kinase pathway that responds to extracellular stimuli, including proinflammatory cytokines and physical stress. As part of the p38 MAPK family, P38β directly activates transcription factors that phosphorylate many proteins, including RPS6KA5/MSK1 and RPS6KA4/MSK2. P38β Protein, Human (sf9) is the recombinant human-derived P38β protein, expressed by sf9 insect cells , with tag free.

Background

P38β, a serine/threonine kinase and an essential component of the MAP kinase signal transduction pathway, operates within the intricate network of cellular responses triggered by extracellular stimuli such as pro-inflammatory cytokines or physical stress. As part of the p38 MAPK family, P38β plays a pivotal role in direct activation of transcription factors, phosphorylating an extensive array of proteins, with an estimated 200 to 300 substrates each. Its functions largely overlap with those of MAPK14, and some of its downstream kinase targets, such as RPS6KA5/MSK1 and RPS6KA4/MSK2, participate in the phosphorylation and activation of transcription factors, chromatin remodeling, and induction of immediate-early genes in response to stress or mitogenic stimuli. Other kinase targets, such as MAPKAPK2/MK2 and MAPKAPK3/MK3, influence gene expression at the post-transcriptional level. In the cytoplasm, P38β regulates protein turnover, exemplified by its phosphorylation of CFLAR, an inhibitor of TNF-induced apoptosis. Furthermore, P38β's involvement in ectodomain shedding of transmembrane proteins, such as ADAM17, highlights its role in cell proliferation and signaling activation. The kinase also phosphorylates NLRP1 downstream of MAP3K20/ZAK, promoting NLRP1 inflammasome activation and pyroptosis in response to UV-B irradiation and ribosome collisions. In the nucleus, P38β emerges as a critical modulator of gene expression by phosphorylating transcription factors and influencing chromatin modifiers and remodelers, thereby regulating processes involved in the inflammatory response.

Species

Human

Source

Sf9 insect cells

Tag

Tag Free

Accession

Q15759 (S2-Q364)

Gene ID

5600

Molecular Construction
N-term
P38β (S2-Q364)
Accession # Q15759
C-term
Protein Length

Partial

Synonyms
MAPK11; Mitogen-activated protein kinase 11; MAP kinase 11; MAPK 11; Mitogen-activated protein kinase p38 beta; MAP kinase p38 beta; p38b; Stress-activated protein kinase 2b; SAPK2b; p38-2
AA Sequence

SGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

P38β Protein, Human (Inactive, sf9)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
P38β Protein, Human (Inactive, sf9)
Cat. No.:
HY-P701730
Quantity:
MCE Japan Authorized Agent: