P38β Protein, Human (Inactive, sf9)
The P38β protein is an important serine/threonine kinase in the MAP kinase pathway that responds to extracellular stimuli, including proinflammatory cytokines and physical stress. As part of the p38 MAPK family, P38β directly activates transcription factors that phosphorylate many proteins, including RPS6KA5/MSK1 and RPS6KA4/MSK2. P38β Protein, Human (sf9) is the recombinant human-derived P38β protein, expressed by sf9 insect cells , with tag free.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
The P38β protein is an important serine/threonine kinase in the MAP kinase pathway that responds to extracellular stimuli, including proinflammatory cytokines and physical stress. As part of the p38 MAPK family, P38β directly activates transcription factors that phosphorylate many proteins, including RPS6KA5/MSK1 and RPS6KA4/MSK2. P38β Protein, Human (sf9) is the recombinant human-derived P38β protein, expressed by sf9 insect cells , with tag free.
P38β, a serine/threonine kinase and an essential component of the MAP kinase signal transduction pathway, operates within the intricate network of cellular responses triggered by extracellular stimuli such as pro-inflammatory cytokines or physical stress. As part of the p38 MAPK family, P38β plays a pivotal role in direct activation of transcription factors, phosphorylating an extensive array of proteins, with an estimated 200 to 300 substrates each. Its functions largely overlap with those of MAPK14, and some of its downstream kinase targets, such as RPS6KA5/MSK1 and RPS6KA4/MSK2, participate in the phosphorylation and activation of transcription factors, chromatin remodeling, and induction of immediate-early genes in response to stress or mitogenic stimuli. Other kinase targets, such as MAPKAPK2/MK2 and MAPKAPK3/MK3, influence gene expression at the post-transcriptional level. In the cytoplasm, P38β regulates protein turnover, exemplified by its phosphorylation of CFLAR, an inhibitor of TNF-induced apoptosis. Furthermore, P38β's involvement in ectodomain shedding of transmembrane proteins, such as ADAM17, highlights its role in cell proliferation and signaling activation. The kinase also phosphorylates NLRP1 downstream of MAP3K20/ZAK, promoting NLRP1 inflammasome activation and pyroptosis in response to UV-B irradiation and ribosome collisions. In the nucleus, P38β emerges as a critical modulator of gene expression by phosphorylating transcription factors and influencing chromatin modifiers and remodelers, thereby regulating processes involved in the inflammatory response.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
Q15759 (S2-Q364)
-
Gene ID5600
-
Molecular Construction
-
N-term
-
P38β (S2-Q364)
Accession # Q15759 -
C-term
-
-
Protein Length
Partial
-
Synonyms
MAPK11; Mitogen-Activated Protein Kinase P38-2; Prev. PRKM11; Stress-Activated Protein Kinase 2b; P38-2; Stress-Activated Protein Kinase-2; SAPK2; Mitogen-Activated Protein Kinase; P38Beta; P38BETA2; Mitogen-Activated Protein Kinase P38 Beta; MAPK 11; MAP
-
AA Sequence
SGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)