PDGF-DD Protein, Human (CHO)
Based on 3 publication(s) in Google Scholar
PDGF-DD Protein, Human (CHO) is a member of the PDGF family, specifically binds to and activates its cognate receptor PDGFR-β, and participates in regulating cancer proliferation, transformation, and invasion through activating multiple downstream oncogenic pathways, resulting in tumor development and progression.
- Species: Human
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
PDGF-DD Protein, Human (CHO) is a member of the PDGF family, specifically binds to and activates its cognate receptor PDGFR-β, and participates in regulating cancer proliferation, transformation, and invasion through activating multiple downstream oncogenic pathways, resulting in tumor development and progression.
Background
PDGF-DD is a member of the PDGF family, specifically binds to and activates its cognate receptor PDGFR-β, and participates in regulating cancer proliferation, transformation, and invasion through activating multiple downstream oncogenic pathways, resulting in tumor development and progression[1].
Verified Bioactivity
ED50 < 5.0 μg/mL, measured in a cell proliferation assay using 3T3 cells.
Publications (3)
-
Journal Impact Factor
-
Most Recent
-
Cell Stem Cell
2026 Mar 23:S1934-5909(26)00080-9. PMID: 41875891 -
-
Anal Chem
Triblock PolyA-Mediated Protein Biosensor Based on a Size-Matching Proximity Hybridization Analysis. [Abstract]2024 Apr 30;96(17):6692-6699. PMID: 38632948
PDGF-DD Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Anal Chem. 2024 Apr 30;96(17):6692-6699. [Abstract]
Specificity investigation of the polyA-mediated PHA. The concentration of VEGF-165 was 5 μg/mL. Error bars represent the SDs (n = 3).
Technical Parameters
-
Species Human
-
Source CHO
-
Tag Tag Free
-
Accession
Q9GZP0-1 (S250-R370)
-
Molecular Construction
-
N-term
-
PDGF-DD (S250-R370)
Accession # Q9GZP0-1 -
C-term
-
-
Protein Length
Full Length of Platelet-derived growth factor D, receptor-binding form Chain
-
Synonyms
PDGFD; Platelet-Derived Growth Factor D; Platelet Derived Growth Factor D; Iris-Expressed Growth Factor; SCDGF-B; SCDGFB; IEGF; PDGF-D; MSTP036; Spinal Cord Derived Growth Factor B; Spinal Cord-Derived Growth Factor B
-
AA Sequence
SYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQRCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALVDIQLDHHERCDCICSSRPPR
-
Molecular Weight
Approximately 19-21 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Structure/Form
Disulfide-linked homodimer
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)