PDGF-DD Protein, Human (CHO)

PDGF-DD Protein, Human (CHO) is a member of the PDGF family, specifically binds to and activates its cognate receptor PDGFR-β, and participates in regulating cancer proliferation, transformation, and invasion through activating multiple downstream oncogenic pathways, resulting in tumor development and progression.

PDGF-DD is a member of the PDGF family, specifically binds to and activates its cognate receptor PDGFR-β, and participates in regulating cancer proliferation, transformation, and invasion through activating multiple downstream oncogenic pathways, resulting in tumor development and progression^[1].

ED₅₀ < 5.0 μg/mL, measured in a cell proliferation assay using 3T3 cells.

Human

CHO

Tag Free

Q9GZP0-1 (S250-R370)

80310  [NCBI]

Partial

SYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQRCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALVDIQLDHHERCDCICSSRPPR

Approximately 19-21 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Huang F, et al. Gastric cancer-derived MSC-secreted PDGF-DD promotes gastric cancer progression. J Cancer Res Clin Oncol. 2014 Nov;140(11):1835-48.  [Content Brief]