Copy Link Print Information

PDGF-DD Protein, Human (CHO)

3 Cited Publications
Customer Review

Based on 3 publication(s) in Google Scholar

PDGF-DD Protein, Human (CHO) is a member of the PDGF family, specifically binds to and activates its cognate receptor PDGFR-β, and participates in regulating cancer proliferation, transformation, and invasion through activating multiple downstream oncogenic pathways, resulting in tumor development and progression.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for PDGF-DD Protein, Human (CHO)
  • PDGF-DD Protein, Human (CHO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PDGF-DD Protein, Human (CHO) is a member of the PDGF family, specifically binds to and activates its cognate receptor PDGFR-β, and participates in regulating cancer proliferation, transformation, and invasion through activating multiple downstream oncogenic pathways, resulting in tumor development and progression.

Background

PDGF-DD is a member of the PDGF family, specifically binds to and activates its cognate receptor PDGFR-β, and participates in regulating cancer proliferation, transformation, and invasion through activating multiple downstream oncogenic pathways, resulting in tumor development and progression[1].

Verified Bioactivity

ED50 < 5.0 μg/mL, measured in a cell proliferation assay using 3T3 cells.

Technical Parameters

  • Species Human
  • Source CHO
  • Tag Tag Free
  • Accession

    Q9GZP0-1 (S250-R370)

  • Gene ID
    80310  [NCBI]
  • Molecular Construction
    • N-term
    • PDGF-DD (S250-R370)
      Accession # Q9GZP0-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PDGFD; Platelet-Derived Growth Factor D; Platelet Derived Growth Factor D; Iris-Expressed Growth Factor; SCDGF-B; SCDGFB; IEGF; PDGF-D; MSTP036; Spinal Cord Derived Growth Factor B; Spinal Cord-Derived Growth Factor B

  • AA Sequence

    SYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQRCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALVDIQLDHHERCDCICSSRPPR

  • Molecular Weight

    Approximately 19-21 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Structure/Form

    Disulfide-linked homodimer

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Huang F, et al. Gastric cancer-derived MSC-secreted PDGF-DD promotes gastric cancer progression. J Cancer Res Clin Oncol. 2014 Nov;140(11):1835-48. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    PDGF-DD Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Anal Chem. 2024 Apr 30;96(17):6692-6699. [Abstract]

    Customer Validation
     Specificity investigation of the polyA-mediated PHA. The concentration of VEGF-165 was 5 μg/mL. Error bars represent the SDs (n = 3).

  • PDGF-DD Protein, Human (CHO) Product Image
    1/16
  • Experimental Validation Results for PDGF-DD Protein, Human (CHO)
  • PDGF-DD Protein, Human (CHO) Product Image

  • PDGF-DD Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Anal Chem. 2024 Apr 30;96(17):6692-6699. [Abstract]

    Specificity investigation of the polyA-mediated PHA. The concentration of VEGF-165 was 5 μg/mL. Error bars represent the SDs (n = 3).