Copy Link Print Information

PDGF-CC Protein, Human (HEK293)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

PDGF-CC Protein, Human (HEK293) is a member of the PDGF family, binds to PDGFR-α and PDGFR-β and acts as potent angiogenic factor.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for PDGF-CC Protein, Human (HEK293)
  • Experimental Validation Results for PDGF-CC Protein, Human (HEK293)
  • Experimental Validation Results for PDGF-CC Protein, Human (HEK293)
  • PDGF-CC Protein, Human (HEK293) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PDGF-CC Protein, Human (HEK293) is a member of the PDGF family, binds to PDGFR-α and PDGFR-β and acts as potent angiogenic factor.

Background

PDGF-CC is a relatively new member of the PDGF family, abundantly expressed by different types of cells, such as tumor cells, endothelial cells (ECs), vascular smooth muscle cells (VSMCs), pericytes, fibroblasts, and macrophages. PDGF-CC binds to PDGFR-α and PDGFR-β, which are also expressed by many different cell types, including tumor cells, VSMCs, pericytes, and fibroblasts, all of which play important roles in angiogenesis. PDGF-CC is a potent angiogenic factor[1].

Verified Bioactivity

Measured in a cell proliferation assay using Balb/3T3 cells. The ED50 for this effect is <1 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession

    Q9NRA1-1 (V235-G345)

  • Gene ID
    56034  [NCBI]
  • Molecular Construction
    • N-term
    • PDGF-CC (V235-G345)
      Accession # Q9NRA1-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PDGFC; Platelet-Derived Growth Factor C; Platelet Derived Growth Factor C; PDGF-C; Fallotein; VEGF-E; SCDGF; Secretory Growth Factor-Like Protein; Spinal Cord-Derived Growth Factor

  • AA Sequence

    VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG

  • Molecular Weight

    Approximately 15-19 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Structure/Form

    Disulfide-linked homodimer

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Zheng L, et al. PDGF-CC underlies resistance to VEGF-A inhibition and combinatorial targeting of both suppresses pathological angiogenesis more efficiently. Oncotarget. 2016 Nov 22;7(47):77902-77915. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using Balb/3T3 cells. The ED50 for this effect is 0.82 ng/mL.

  • 1/16

    PDGF-CC Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Anal Chem. 2024 Apr 30;96(17):6692-6699. [Abstract]

    Customer Validation
     Specificity investigation of the polyA-mediated PHA. The concentration of VEGF-165 was 5 μg/mL. Error bars represent the SDs (n = 3).

  • PDGF-CC Protein, Human (HEK293) Product Image
    1/16
  • Experimental Validation Results for PDGF-CC Protein, Human (HEK293)
  • Experimental Validation Results for PDGF-CC Protein, Human (HEK293)
  • Experimental Validation Results for PDGF-CC Protein, Human (HEK293)
  • PDGF-CC Protein, Human (HEK293) Product Image

  • PDGF-CC Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Anal Chem. 2024 Apr 30;96(17):6692-6699. [Abstract]

    Specificity investigation of the polyA-mediated PHA. The concentration of VEGF-165 was 5 μg/mL. Error bars represent the SDs (n = 3).