1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. PDGF & PDGFR
  4. PDGF
  5. PDGF-CC Protein, Human (HEK293)

PDGF-CC Protein, Human (HEK293)

Cat. No.: HY-P7279
Handling Instructions

PDGF-CC Protein, Human (HEK293) is a member of the PDGF family, binds to PDGFR-α and PDGFR-β and acts as potent angiogenic factor.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $150 In-stock
Estimated Time of Arrival: December 31
50 μg $450 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

PDGF-CC Protein, Human (HEK293) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

HEK293

Tag

Tag Free

Accession

Q9NRA1 (V235-G345)

Gene ID

56034

Synonyms
rHuPDGF-CC; PDGF-C; SCDGF
AA Sequence

VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG

Molecular Weight

15-19 kDa

Biological Activity
The ED50 is <1 ng/mL as measured by 3T3 cells.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

PDGF-CC is a relatively new member of the PDGF family, abundantly expressed by different types of cells, such as tumor cells, endothelial cells (ECs), vascular smooth muscle cells (VSMCs), pericytes, fibroblasts, and macrophages. PDGF-CC binds to PDGFR-α and PDGFR-β, which are also expressed by many different cell types, including tumor cells, VSMCs, pericytes, and fibroblasts, all of which play important roles in angiogenesis. PDGF-CC is a potent angiogenic factor[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDGF-CC Protein, Human (HEK293)
Cat. No.:
HY-P7279
Quantity:
MCE Japan Authorized Agent: