Copy Link Print Information

PDGF-AA Protein, Human

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

PDGF-A protein is a key growth factor that regulates embryonic development, cell proliferation, migration, survival, and chemotaxis, and exerts potent mitogenic effects on mesenchymal cells. It is essential for alveolar septal formation, gastrointestinal tract development, interstitial cell maturation, spermatogenesis, and oligodendrocyte development, and contributes to spinal cord and cerebellar myelination. PDGF-AA Protein, Human is the recombinant human-derived PDGF-AA protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for PDGF-AA Protein, Human
  • Experimental Validation Results for PDGF-AA Protein, Human
  • Experimental Validation Results for PDGF-AA Protein, Human
  • Experimental Validation Results for PDGF-AA Protein, Human
  • Experimental Validation Results for PDGF-AA Protein, Human
  • Experimental Validation Results for PDGF-AA Protein, Human
  • Experimental Validation Results for PDGF-AA Protein, Human
  • PDGF-AA Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PDGF-A protein is a key growth factor that regulates embryonic development, cell proliferation, migration, survival, and chemotaxis, and exerts potent mitogenic effects on mesenchymal cells. It is essential for alveolar septal formation, gastrointestinal tract development, interstitial cell maturation, spermatogenesis, and oligodendrocyte development, and contributes to spinal cord and cerebellar myelination. PDGF-AA Protein, Human is the recombinant human-derived PDGF-AA protein, expressed by E. coli , with tag free.

Background

PDGF-A Protein takes center stage as a pivotal growth factor regulating embryonic development, cell proliferation, migration, survival, and chemotaxis. Acknowledged for its potent mitogenic effects on mesenchymal cells, PDGF-A is indispensable for various developmental processes, including the formation of lung alveolar septa, gastrointestinal tract development, Leydig cell maturation, spermatogenesis, and the normal development of oligodendrocytes, contributing to myelination in the spinal cord and cerebellum. Furthermore, PDGF-A assumes a crucial role in wound healing dynamics. The intricacies of its signaling pathway involve modulation through the formation of heterodimers with PDGFB, demonstrating its regulatory versatility. Structurally, PDGF-A adopts a homodimeric configuration with an antiparallel disulfide-linked dimer, and it forms heterodimers with PDGFB, engaging in interactions with PDGFRA homodimers and heterodimers formed by PDGFRA and PDGFRB. Additionally, PDGF-A exhibits an interaction with CSPG4, adding another layer to its multifaceted involvement in cellular processes.

Verified Bioactivity

Measured in a cell proliferation assay using Balb/c 3T3 mouse fibroblast cells. The  ED50 for this effect is <20 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P04085-1 (S87-T211)

  • Gene ID
    5154  [NCBI]
  • Molecular Construction
    • N-term
    • PDGF-AA (S87-T211)
      Accession # P04085-1
    • C-term
  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Synonyms

    PDGFA; Platelet-Derived Growth Factor Alpha Chain; Platelet Derived Growth Factor Subunit A; Platelet-Derived Growth Factor A Chain; Platelet-Derived Growth Factor Alpha Polypeptide; PDGF Subunit A; PDGF1; PDGF A-Chain; Platelet-Derived Growth Factor Subu

  • AA Sequence

    SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT

  • Predicted Molecular Mass

    14.3 kDa

  • Molecular Weight

    Approximately 16 kDa under reduced (R) conditions, 27-33 kDa under non reducing (N) conditions, based on SDS-PAGE, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Glycine-HCl, 6% sucrose, 4% mannitol, 0.02% Tween 80, pH 3.0.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
3.Lyophilized from a 0.22 μm filtered solution of 0.1% TFA, 20% Acetonitrile, pH 2.5.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using Balb/c 3T3 mouse fibroblast cells. The ED50 for this effect is 7.548 ng/mL, corresponding to a specific activity is 1.324×105units/mg.

  • 1/16

    PDGF-AA Protein, Human purchased from MedChemExpress. Usage Cited in: Research Square Preprint. 2022 Feb.

    Customer Validation
     Pretreatment with PDGF-AA Protein, Human (25 ng/ml) stimulated growth of HUVECs.

  • 1/16

    PDGF-AA Protein, Human purchased from MedChemExpress. Usage Cited in: Research Square Preprint. 2022 Feb.

    Customer Validation
     PDGF-AA Protein, Human (25 ng/ml) stimulation increased HUVEC migration to the lower chamber.

  • 1/16

    PDGF-AA Protein, Human purchased from MedChemExpress. Usage Cited in: Research Square Preprint. 2022 Feb.

    Customer Validation
     PDGF-AA Protein, Human (25 ng/ml) induced activation of PDGFRα in HUVECs.

  • 1/16

    PDGF-AA Protein, Human purchased from MedChemExpress. Usage Cited in: Research Square Preprint. 2022 Feb.

    Customer Validation
     PDGF-AA Protein, Human (25 ng/ml) induced colony formation of HUVECs.

  • 1/16

    PDGF-AA Protein, Human purchased from MedChemExpress. Usage Cited in: Research Square Preprint. 2022 Feb.

    Customer Validation
     PDGF-AA Protein, Human (25 ng/ml) increased tube formation in HUVECs.

  • PDGF-AA Protein, Human Product Image
    1/16
  • Experimental Validation Results for PDGF-AA Protein, Human
  • Experimental Validation Results for PDGF-AA Protein, Human
  • Experimental Validation Results for PDGF-AA Protein, Human
  • Experimental Validation Results for PDGF-AA Protein, Human
  • Experimental Validation Results for PDGF-AA Protein, Human
  • Experimental Validation Results for PDGF-AA Protein, Human
  • Experimental Validation Results for PDGF-AA Protein, Human
  • PDGF-AA Protein, Human Product Image