1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. IGF family
  4. Insulin-like Growth Factor I (IGF-1)
  5. IGF-I/IGF-1 Protein, Human (70a.a)

IGF-I/IGF-1 Protein is an insulin-like growth factor that possesses both growth-promoting and metabolic-regulating functions. IGF-I/IGF-1 Protein is also a neurotrophic factor with neuroprotective and neuroplasticity-regulating activities. IGF-I/IGF-1 Protein plays a key role in growth and development, cell proliferation, metabolic regulation and other aspects. IGF-I/IGF-1 protein, Human (70a.a) is a recombinant IGF-I/IGF-1 protein expressed by E. coli without a tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

    IGF-I/IGF-1 Protein, Human (70a.a) purchased from MCE. Usage Cited in: Adv Sci (Weinh). 2025 Sep 17:e08111.  [Abstract]

    Following pretreatment with Insig1/2 loop 1 peptide (15 µm) and IGF1 stimulation (100 ng/mL; 8 h), Huh7 cells were subjected to immunofluorescence analysis.

    IGF-I/IGF-1 Protein, Human (70a.a) purchased from MCE. Usage Cited in: Adv Sci (Weinh). 2025 Sep 17:e08111.  [Abstract]

    Quantitative PCR analysis of SREBP1 target gene GPAM in Huh7 cells pretreated with Insig1/2 loop 1 peptide (15 µM) and stimulated with IGF1 (100 ng/mL; 10 h) .

    IGF-I/IGF-1 Protein, Human (70a.a) purchased from MCE. Usage Cited in: Adv Sci (Weinh). 2025 Sep 17:e08111.  [Abstract]

    Intracellular triglyceride (TG) content was quantified in Huh7 cells pretreated with Insig1/2 loop 1 peptide (25 µM) and stimulated with IGF1 (100 ng/mL; 24 h) .

    IGF-I/IGF-1 Protein, Human (70a.a) purchased from MCE. Usage Cited in: Adv Sci (Weinh). 2025 Sep 17:e08111.  [Abstract]

    Cell proliferation was assessed by automated cell counting of IGF1 stimulation (100 ng/mL; 72 h) in Huh7 cells pretreated with Insig1/2 loop 1 peptide (25 µM) for 1 h.

    IGF-I/IGF-1 Protein, Human (70a.a) purchased from MCE. Usage Cited in: Cell Rep. 2022 Dec 20;41(12):111834.  [Abstract]

    The phosphorylation of IGF-1R and coIP of c-Cbl and IGF-1R with anti-IGF-1R polyclonal antibody in the presence of or absence of IGF-1 (100 ng/mL) without FBS in the culture media.
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    IGF-I/IGF-1 Protein is an insulin-like growth factor that possesses both growth-promoting and metabolic-regulating functions. IGF-I/IGF-1 Protein is also a neurotrophic factor with neuroprotective and neuroplasticity-regulating activities. IGF-I/IGF-1 Protein plays a key role in growth and development, cell proliferation, metabolic regulation and other aspects. IGF-I/IGF-1 protein, Human (70a.a) is a recombinant IGF-I/IGF-1 protein expressed by E. coli without a tag[1][2][3][4].

    Background

    IGF system has been demonstrated to regulate the growth of numerous tissues, such as neural tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone. IGF-I/IGF-1, a key growth factor involved in cell growth, differentiation, survival, and cell cycle regulation, is secreted by mature osteoblasts, stored in the bone matrix, and released during bone resorption. The mitogenic effect of IGF-I/IGF-1 is mediated through its binding to IGF plasma membrane receptors. IGF-I/IGF-1 can stimulate osteoblast proliferation and differentiation, and also promote neuronal survival[1][2][3][4].

    In Vitro

    IGF-I/IGF-1 protein (Human; 50 ng/mL; 48 h) can activate the PI3K/Akt/mTOR signaling pathway and alleviate the apoptosis induced by 5-Heptadecylresorcinol (AR-C17; HY-N2673) in MCF-7 cells[3].

    In Vivo

    IGF-I/IGF-1 Protein (Human; 0.3-10 μg/day; intraventricular infusion; 7 days) exerts a neuroprotective effect in a mouse model of traumatic brain injury, promoting hippocampal neurogenesis and improving motor and cognitive functions[4].

    Biological Activity

    1.ED50 is < 5 ng/mL, measured by a cell proliferation assay using FDC-P1 cells, corresponding to a specific activity of > 2.0×105 units/mg.
    2.Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 for this effect is < 5 ng/mL.

    • Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 for this effect is 4.281 ng/mL. corresponding to a specific activity is 2.33×10^5 units/mg.
    Species

    Human

    Source

    E. coli

    Tag

    Tag Free

    Accession

    P05019-1 (G49-A118)

    Gene ID
    Molecular Construction
    N-term
    IGF1 (G49-A118)
    Accession # P05019-1
    C-term
    Protein Length

    Full Length of Isoform-1 Mature Protein

    Synonyms
    rHuIGF-1; IGF-IA; Somatamedin C; MGF; IGF-I
    AA Sequence

    GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

    Molecular Weight

    Approximately 8-9 kDa, based on SDS-PAGE under reducing conditions.

    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
    2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
    Please refer to the lot-specific COA for specific buffer information.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References

    IGF-I/IGF-1 Protein, Human (70a.a) Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    IGF-I/IGF-1 Protein, Human (70a.a)

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    IGF-I/IGF-1 Protein, Human (70a.a)
    Cat. No.:
    HY-P7018
    Quantity:
    MCE Japan Authorized Agent: