Copy Link Print Information

IGF-I/IGF-1 Protein, Human (70a.a)

27 Cited Publications
Customer Review

Based on 27 publication(s) in Google Scholar

IGF-I/IGF-1 Protein is an insulin-like growth factor that possesses both growth-promoting and metabolic-regulating functions. IGF-I/IGF-1 Protein is also a neurotrophic factor with neuroprotective and neuroplasticity-regulating activities. IGF-I/IGF-1 Protein plays a key role in growth and development, cell proliferation, metabolic regulation and other aspects. IGF-I/IGF-1 protein, Human (70a.a) is a recombinant IGF-I/IGF-1 protein expressed by E. coli without a tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (70a.a)
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (70a.a)
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (70a.a)
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (70a.a)
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (70a.a)
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (70a.a)
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (70a.a)
  • IGF-I/IGF-1 Protein, Human (70a.a) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IGF-I/IGF-1 Protein is an insulin-like growth factor that possesses both growth-promoting and metabolic-regulating functions. IGF-I/IGF-1 Protein is also a neurotrophic factor with neuroprotective and neuroplasticity-regulating activities. IGF-I/IGF-1 Protein plays a key role in growth and development, cell proliferation, metabolic regulation and other aspects. IGF-I/IGF-1 protein, Human (70a.a) is a recombinant IGF-I/IGF-1 protein expressed by E. coli without a tag[1][2][3][4].

Background

IGF system has been demonstrated to regulate the growth of numerous tissues, such as neural tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone. IGF-I/IGF-1, a key growth factor involved in cell growth, differentiation, survival, and cell cycle regulation, is secreted by mature osteoblasts, stored in the bone matrix, and released during bone resorption. The mitogenic effect of IGF-I/IGF-1 is mediated through its binding to IGF plasma membrane receptors. IGF-I/IGF-1 can stimulate osteoblast proliferation and differentiation, and also promote neuronal survival[1][2][3][4].

In Vitro

IGF-I/IGF-1 protein (Human; 50 ng/mL; 48 h) can activate the PI3K/Akt/mTOR signaling pathway and alleviate the apoptosis induced by 5-Heptadecylresorcinol (AR-C17; HY-N2673) in MCF-7 cells[3].

In Vivo

IGF-I/IGF-1 Protein (Human; 0.3-10 μg/day; intraventricular infusion; 7 days) exerts a neuroprotective effect in a mouse model of traumatic brain injury, promoting hippocampal neurogenesis and improving motor and cognitive functions[4].

Verified Bioactivity

1.ED50 is < 5 ng/mL, measured by a cell proliferation assay using FDC-P1 cells, corresponding to a specific activity of > 2.0×105 units/mg.
2.Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 for this effect is < 5 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P05019-1 (G49-A118)

  • Gene ID
    3479  [NCBI]
  • Molecular Construction
    • N-term
    • IGF1 (G49-A118)
      Accession # P05019-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    IGF1; Somatomedin-C; Insulin Like Growth Factor 1; IGF1A; IGF-I; MGF; Insulin-Like Growth Factor 1; Insulin-Like Growth Factor IB; Insulin-Like Growth Factor I; Insulin-Like Growth Factor-I; IGFI; Alternative Protein IGF1; IGF; Somatomedin C; Insulin-Like

  • AA Sequence

    GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

  • Molecular Weight

    Approximately 8-9 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Richman C, et al. Recombinant human insulin-like growth factor-binding protein-5 stimulates bone formation parameters in vitro and in vivo. Endocrinology. 1999 Oct;140(10):4699-705. [Content Brief]

[2]. Zhang R, et al. Effects of TGF-beta1 and IGF-1 on proliferation of human nucleus pulposus cells in medium with different serum concentrations. J Orthop Surg Res. 2006 Oct 26;1:9. [Content Brief]

[3]. Mingsi X, et al. Inhibitory effects of 5-heptadecylresorcinol on the proliferation of human MCF-7 breast cancer cells through modulating PI3K/Akt/mTOR pathway. Journal of Functional Foods, 2020, 69: 103946.

[4]. Carlson SW, et al. Central Infusion of Insulin-Like Growth Factor-1 Increases Hippocampal Neurogenesis and Improves Neurobehavioral Function after Traumatic Brain Injury. J Neurotrauma. 2018 Jul 1;35(13):1467-1480. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 for this effect is 4.281 ng/mL. corresponding to a specific activity is 2.33×10^5 units/mg.

  • 1/16

    IGF-I/IGF-1 Protein, Human (70a.a) purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2025 Sep 17:e08111. [Abstract]

    Customer Validation
     Following pretreatment with Insig1/2 loop 1 peptide (15 µm) and IGF1 stimulation (100 ng/mL; 8 h), Huh7 cells were subjected to immunofluorescence analysis.

  • 1/16

    IGF-I/IGF-1 Protein, Human (70a.a) purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2025 Sep 17:e08111. [Abstract]

    Customer Validation
     Quantitative PCR analysis of SREBP1 target gene GPAM in Huh7 cells pretreated with Insig1/2 loop 1 peptide (15 µM) and stimulated with IGF1 (100 ng/mL; 10 h) .

  • 1/16

    IGF-I/IGF-1 Protein, Human (70a.a) purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2025 Sep 17:e08111. [Abstract]

    Customer Validation
     Intracellular triglyceride (TG) content was quantified in Huh7 cells pretreated with Insig1/2 loop 1 peptide (25 µM) and stimulated with IGF1 (100 ng/mL; 24 h) .

  • 1/16

    IGF-I/IGF-1 Protein, Human (70a.a) purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2025 Sep 17:e08111. [Abstract]

    Customer Validation
     Cell proliferation was assessed by automated cell counting of IGF1 stimulation (100 ng/mL; 72 h) in Huh7 cells pretreated with Insig1/2 loop 1 peptide (25 µM) for 1 h.

  • 1/16

    IGF-I/IGF-1 Protein, Human (70a.a) purchased from MedChemExpress. Usage Cited in: Cell Rep. 2022 Dec 20;41(12):111834. [Abstract]

    Customer Validation
     The phosphorylation of IGF-1R and coIP of c-Cbl and IGF-1R with anti-IGF-1R polyclonal antibody in the presence of or absence of IGF-1 (100 ng/mL) without FBS in the culture media.

  • IGF-I/IGF-1 Protein, Human (70a.a) Product Image
    1/16
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (70a.a)
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (70a.a)
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (70a.a)
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (70a.a)
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (70a.a)
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (70a.a)
  • Experimental Validation Results for IGF-I/IGF-1 Protein, Human (70a.a)
  • IGF-I/IGF-1 Protein, Human (70a.a) Product Image

  • IGF-I/IGF-1 Protein, Human (70a.a) purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2025 Sep 17:e08111. [Abstract]

    Following pretreatment with Insig1/2 loop 1 peptide (15 µm) and IGF1 stimulation (100 ng/mL; 8 h), Huh7 cells were subjected to immunofluorescence analysis.

  • IGF-I/IGF-1 Protein, Human (70a.a) purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2025 Sep 17:e08111. [Abstract]

    Quantitative PCR analysis of SREBP1 target gene GPAM in Huh7 cells pretreated with Insig1/2 loop 1 peptide (15 µM) and stimulated with IGF1 (100 ng/mL; 10 h) .

  • IGF-I/IGF-1 Protein, Human (70a.a) purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2025 Sep 17:e08111. [Abstract]

    Intracellular triglyceride (TG) content was quantified in Huh7 cells pretreated with Insig1/2 loop 1 peptide (25 µM) and stimulated with IGF1 (100 ng/mL; 24 h) .

  • IGF-I/IGF-1 Protein, Human (70a.a) purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2025 Sep 17:e08111. [Abstract]

    Cell proliferation was assessed by automated cell counting of IGF1 stimulation (100 ng/mL; 72 h) in Huh7 cells pretreated with Insig1/2 loop 1 peptide (25 µM) for 1 h.

  • IGF-I/IGF-1 Protein, Human (70a.a) purchased from MedChemExpress. Usage Cited in: Cell Rep. 2022 Dec 20;41(12):111834. [Abstract]

    The phosphorylation of IGF-1R and coIP of c-Cbl and IGF-1R with anti-IGF-1R polyclonal antibody in the presence of or absence of IGF-1 (100 ng/mL) without FBS in the culture media.