1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. IGF family
  4. Insulin-like Growth Factor I (IGF-1)
  5. IGF-I/IGF-1 Protein, Human (70a.a)

IGF-I/IGF-1 Protein, Human (70a.a)

Cat. No.: HY-P7018
Handling Instructions

IGF-I/IGF-1 Protein, Human (70a.a) is a mitogenic cytokine, binds to IGF type 1 receptor, and modulates growth in many tissues, such as nervous tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone; IGF-I/IGF-1 Protein also mediates neuroprotective mechanism.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $50 In-stock
Estimated Time of Arrival: December 31
50 μg $100 In-stock
Estimated Time of Arrival: December 31
100 μg $130 In-stock
Estimated Time of Arrival: December 31
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IGF-I/IGF-1 Protein, Human (70a.a) is a mitogenic cytokine, binds to IGF type 1 receptor, and modulates growth in many tissues, such as nervous tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone; IGF-I/IGF-1 Protein also mediates neuroprotective mechanism.

Background

Insulin-like growth factor (IGF) system has been shown to modulate growth in many tissues, such as nervous tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone. Insulin-like Growth factor-1 (IGF-I) is produced by osteoblasts, and its mitogenic effects are mediated by their binding to the IGF plasma membrane receptors. The IGF type 1 receptor binding to both IGF-I and IGF-II, is thought to be the predominate receptor involved in mediating the effects of these growth factors in most cell types, including osteoblasts[1]. Insulin-like growth factor-1 (IGF-1) is a neurotrophic factor capable of mediating neuroprotective and neuroplasticity mechanisms. Targeted overexpression of IGF-1 enhances the generation of hippocampal newborn neurons in brain-injured mice[2].

Biological Activity
The ED50 is <5 ng/mL as measured by FDC-P1 cells, corresponding to a specific activity of >2.0 × 105 units/mg.
Species

Human

Source

E. coli

Accession

P05019 (G49-A118)

Gene ID
Synonyms
rHuIGF-1; IGF-IA; Somatamedin C; MGF; IGF-I
AA Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molecular Weight

Approximately 7.7 kDa

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IGF-I/IGF-1 Protein, Human (70a.a) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IGF-I/IGF-1 Protein, Human (70a.a)
Cat. No.:
HY-P7018
Quantity:
MCE Japan Authorized Agent: