1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins AGC
  4. PDK1
  5. PDPK1/PDK1
  6. PDPK1 Protein, Human (sf9)

PDPK1 protein is the core kinase of the AGC family and can phosphorylate and activate various downstream kinases, including PKB/AKT1, RPS6KB1, PRKACA, PRKCD, SGK1, PAK1 and PKN. It transduces insulin signals and regulates cellular processes such as proliferation, survival, and nutrient absorption. PDPK1 Protein, Human (sf9) is the recombinant human-derived PDPK1 protein, expressed by sf9 insect cells , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE PDPK1 Protein, Human (sf9)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PDPK1 protein is the core kinase of the AGC family and can phosphorylate and activate various downstream kinases, including PKB/AKT1, RPS6KB1, PRKACA, PRKCD, SGK1, PAK1 and PKN. It transduces insulin signals and regulates cellular processes such as proliferation, survival, and nutrient absorption. PDPK1 Protein, Human (sf9) is the recombinant human-derived PDPK1 protein, expressed by sf9 insect cells , with tag free.

Background

PDPK1, a serine/threonine kinase, assumes a central role as a master kinase within the AGC family, orchestrating the phosphorylation and activation of various downstream protein kinases. Its diverse targets include protein kinase B (PKB/AKT1, PKB/AKT2, PKB/AKT3), p70 ribosomal protein S6 kinase (RPS6KB1), p90 ribosomal protein S6 kinase (RPS6KA1, RPS6KA2, and RPS6KA3), cyclic AMP-dependent protein kinase (PRKACA), protein kinase C (PRKCD and PRKCZ), serum and glucocorticoid-inducible kinase (SGK1, SGK2, and SGK3), p21-activated kinase-1 (PAK1), and protein kinase PKN (PKN1 and PKN2). PDPK1 plays a pivotal role in transducing insulin signals by activating PKB/AKT1, thereby regulating downstream targets involved in cell proliferation, survival, glucose and amino acid uptake, and storage. Additionally, it exerts regulatory functions, negatively modulating TGF-beta-induced signaling and activating PPARG transcriptional activity to promote adipocyte differentiation. PDPK1 further participates in diverse cellular processes, including the activation of the NF-kappa-B pathway via IKKB phosphorylation, regulation of focal adhesions by angiotensin II, control of pancreatic cell proliferation, and modulation of Ca(2+) entry and Ca(2+)-activated K(+) channels in mast cells. It also plays critical roles in endothelial cell motility, cardiac homeostasis, thymocyte development, and provides negative feedback inhibition in toll-like receptor-mediated NF-kappa-B activation in macrophages, with isoform 3 being catalytically inactive.

Species

Human

Source

Sf9 insect cells

Tag

Tag Free

Accession

O15530 (M51-A360)

Gene ID

5170

Molecular Construction
N-term
PDPK1 (M51-A360)
Accession # O15530
C-term
Protein Length

Partial

Synonyms
PDPK1; 3-phosphoinositide-dependent protein kinase 1; hPDK1
AA Sequence

MDGTAAEPRPGAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTA

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PDPK1 Protein, Human (sf9)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDPK1 Protein, Human (sf9)
Cat. No.:
HY-P701738
Quantity:
MCE Japan Authorized Agent: