Betacellulin Protein, Human (HEK293)

Customer Review

Based on 1 Customer Validation

Probetacellulin Protein, Human (HEK293) is a glycoprotein produced in HEK293 cells, improves glucose tolerance by promoting β-cell differentiation and regeneration from ductal and/or acinar cells.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

Probetacellulin Protein, Human (HEK293) is a glycoprotein produced in HEK293 cells, improves glucose tolerance by promoting β-cell differentiation and regeneration from ductal and/or acinar cells.

Background

Betacellulin (BTC), a member of the epidermal growth factor family, is expressed predominantly in the human pancreas and induces the differentiation of a pancreatic acinar cell line (AR42J) into insulin-secreting cells. Betacellulin binds and activates the EGF receptor (EGFR/erbB-1) and erbB-4, and it induces tyrosine phosphorylation of erbB-2, which couples with the EGFR or erbB-4[1].

Verified Bioactivity

The ED50 is <4 pg/mL as measured by 3T3 cells.

MCE Validation Data

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 is <0.4050 ng/mL, corresponding to a specific activity of >2.4691× 106 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Betacellulin (D32-Y111)
      Accession # P35070
    • C-term
  • Protein Length

    Full Length of Betacellulin Chain

  • Synonyms

    BTC; Probetacellulin; Betacellulin; Betacellulin Isoform 2

  • AA Sequence

    DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY

  • Molecular Weight

    Approximately 15-18 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00