1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Prolactin
  5. Prolactin Protein, Mouse (sf9, His)

Prolactin proteins exhibit hormone and receptor binding activities. It regulates mammary gland development, maternal behavior, and JAK-STAT signaling. Prolactin Protein, Mouse (sf9, His) is the recombinant mouse-derived Prolactin protein, expressed by sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Prolactin proteins exhibit hormone and receptor binding activities. It regulates mammary gland development, maternal behavior, and JAK-STAT signaling. Prolactin Protein, Mouse (sf9, His) is the recombinant mouse-derived Prolactin protein, expressed by sf9 insect cells , with C-His labeled tag.

Background

Prolactin, a versatile protein, is predicted to exhibit hormone activity and prolactin receptor binding activity. It plays a pivotal role upstream of various processes, including mammary gland development, maternal behavior, and positive regulation of the receptor signaling pathway via JAK-STAT. Found in secretory granules, prolactin demonstrates expression in key structures such as the hippocampus, pituitary gland, placenta, and trophoblast giant cell. The human ortholog of this gene, PRL (prolactin), has implications in carotid artery disease, suggesting its potential involvement in physiological and pathological contexts. Investigations into prolactin function may contribute to a deeper understanding of its diverse roles and its impact on health.

Biological Activity

1.Measured by its ability to promote proliferation of INS-1 cells and the ED50 is typically 50-500 ng/mL.
2.Measured by its ability to induce PRL pathway activation in a Luciferase receptor Assay System. The ED50 for this effect is typically 50-500 ng/mL.

Species

Mouse

Source

Sf9 insect cells

Tag

C-His

Accession

NP_035294.2 (L32-C228)

Gene ID
Molecular Construction
N-term
Prolactin (L32-C228)
Accession # NP_035294.2
His
C-term
Protein Length

Full Length of prolactin_like

Synonyms
PRL; Prolactin
AA Sequence

LPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC

Molecular Weight

Approximately 23-26 kDa

Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

1.Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 10% glycerol.
2.Supplied as a 0.22 μm filtered solution of pH 7.5, 10% glycerol, 300 mM NaCl, 20 mM Tris.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Prolactin Protein, Mouse (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Prolactin Protein, Mouse (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Prolactin Protein, Mouse (sf9, His)
Cat. No.:
HY-P73381
Quantity:
MCE Japan Authorized Agent: