Copy Link Print Information

Prolactin Protein, Mouse (sf9, His)

Customer Review

Based on 1 Customer Validation

Prolactin proteins exhibit hormone and receptor binding activities. It regulates mammary gland development, maternal behavior, and JAK-STAT signaling. Prolactin Protein, Mouse (sf9, His) is the recombinant mouse-derived Prolactin protein, expressed by sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for Prolactin Protein, Mouse (sf9, His)
  • Prolactin Protein, Mouse (sf9, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Prolactin proteins exhibit hormone and receptor binding activities. It regulates mammary gland development, maternal behavior, and JAK-STAT signaling. Prolactin Protein, Mouse (sf9, His) is the recombinant mouse-derived Prolactin protein, expressed by sf9 insect cells , with C-His labeled tag.

Background

Prolactin, a versatile protein, is predicted to exhibit hormone activity and prolactin receptor binding activity. It plays a pivotal role upstream of various processes, including mammary gland development, maternal behavior, and positive regulation of the receptor signaling pathway via JAK-STAT. Found in secretory granules, prolactin demonstrates expression in key structures such as the hippocampus, pituitary gland, placenta, and trophoblast giant cell. The human ortholog of this gene, PRL (prolactin), has implications in carotid artery disease, suggesting its potential involvement in physiological and pathological contexts. Investigations into prolactin function may contribute to a deeper understanding of its diverse roles and its impact on health.

Verified Bioactivity

1.Measured by its ability to promote proliferation of INS-1 cells and the ED50 is typically 50-500 ng/mL.
2.Measured by its ability to induce PRL pathway activation in a Luciferase receptor Assay System. The ED50 for this effect is typically 50-500 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source Sf9 insect cells
  • Tag C-His
  • Accession

    P06879 (L30-C226)

  • Gene ID
    19109  [NCBI]
  • Molecular Construction
    • N-term
    • Prolactin (L30-C226)
      Accession # P06879
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PRL; PPRL; Prolactin; GHA1; Luteotropic Hormone; Decidual Prolactin; Prolactin Peptide; Growth Hormone A1; Luteotropin

  • AA Sequence

    LPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC

  • Predicted Molecular Mass

    23.8 kDa

  • Molecular Weight

    Approximately 26 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

1.Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 10% glycerol.
2.Supplied as a 0.22 μm filtered solution of pH 7.5, 10% glycerol, 300 mM NaCl, 20 mM Tris.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • Prolactin Protein, Mouse (sf9, His) Product Image
    1/16
  • Experimental Validation Results for Prolactin Protein, Mouse (sf9, His)
  • Prolactin Protein, Mouse (sf9, His) Product Image