Copy Link Print Information

Prolactin Protein, Human (HEK293, His)

3 Cited Publications
Customer Review

Based on 3 publication(s) in Google Scholar

Prolactin Protein acts on the mammary gland, promoting lactation through its interaction with the receptor PRLR. Prolactin Protein, Human (HEK293, His) is the recombinant human-derived Prolactin protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Prolactin Protein, Human (HEK293, His)
  • Experimental Validation Results for Prolactin Protein, Human (HEK293, His)
  • Experimental Validation Results for Prolactin Protein, Human (HEK293, His)
  • Experimental Validation Results for Prolactin Protein, Human (HEK293, His)
  • Experimental Validation Results for Prolactin Protein, Human (HEK293, His)
  • Experimental Validation Results for Prolactin Protein, Human (HEK293, His)
  • Experimental Validation Results for Prolactin Protein, Human (HEK293, His)
  • Prolactin Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Prolactin Protein acts on the mammary gland, promoting lactation through its interaction with the receptor PRLR. Prolactin Protein, Human (HEK293, His) is the recombinant human-derived Prolactin protein, expressed by HEK293 , with C-His labeled tag.

Background

Prolactin is a protein that primarily acts on the mammary gland by promoting lactation. It achieves this by interacting with its receptor, PRLR.

In Vitro

Prolactin Protein, Human (10 ng/mL, 1 h-25 days) promotes the proliferation and cytotoxicity of SCID mouse NK cells[1].

In Vivo

Prolactin Protein, Human (10 μg/mouse/day, ip, once daily or every two days, 5 doses) promotes the reconstitution of NK cells after allogeneic bone marrow transplantation in BALB/c mouse transplantation model, prolongs the survival of CT26 tumor-transplanted mice and reduces the number of lung metastases in mouse tumor models[1].

Verified Bioactivity

Measured in a cell proliferation assay using Nb2-11 rat lymphoma cells. The ED50 this effect is 0.1656-0.4161 ng/mL, corresponding to a specific activity is 6.038×106 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using Nb2-11 rat lymphoma cells. The ED50 for this effect is 0.1656 ng/mL, corresponding to a specific activity is 6.038×106 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession

    P01236 (L29-C227)

  • Gene ID
    5617  [NCBI]
  • Molecular Construction
    • N-term
    • Prolactin (L29-C227)
      Accession # P01236
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PRL; PPRL; Prolactin; GHA1; Luteotropic Hormone; Decidual Prolactin; Prolactin Peptide; Growth Hormone A1; Luteotropin

  • AA Sequence

    LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

  • Molecular Weight

    Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 5% trehalose, 5% mannitol, 0.01% Tween 80, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Sun R, et al., Recombinant human prolactin improves antitumor effects of murine natural killer cells in vitro and in vivo. Neuroimmunomodulation. 2002-2003;10(3):169-76. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using Nb2-11 rat lymphoma cells. The ED50 for this effect is 0.1656 ng/mL, corresponding to a specific activity is 6.038×106 units/mg.

  • 1/16

    Prolactin Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: bioRxiv. 2025 Oct 13.

    Customer Validation
     Prolactin Protein, Human (HEK293, His) (100 ng/m; 6 h) pretreated with JAK2/STAT3 inhibitor FLLL32 (10 μM) for 1 h significantly upregulated the mRNA expression of Ccl2 and Ccl7 in NIH-3T3 cells.

  • 1/16

    Prolactin Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: bioRxiv. 2025 Oct 13.

    Customer Validation
     Prolactin Protein, Human (HEK293, His) (0, 1, 10, and 100 ng/mL; 30 min) induced the activation of JAK2 and STAT3, rather than STAT1 and STAT5 in NIH-3T3 cells.

  • 1/16

    Prolactin Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: bioRxiv. 2025 Oct 13.

    Customer Validation
     Prolactin Protein, Human (HEK293, His) (100 ng/mL; 30 min)transfected with siRNA targeting Prlr or scrambled control for 24 h showed inhibition of the activation of JAK2 and STAT3 in Prlr knockdown cells.

  • 1/16

    Prolactin Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: bioRxiv. 2025 Oct 13.

    Customer Validation
     Prolactin Protein, Human (HEK293, His) (100 ng/mL; 24 h) induced CCL2 and CCL7 expression in human skin explant.

  • 1/16

    Prolactin Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: J Funct Foods. 2023 Aug, 107, 105706.

    Customer Validation
     Flow cytometry analysis of the percent of Ki67 positive cells (proliferative cells) from cultured SJ β-cells in response to 0.75 mg/ml dextran, 0.75 mg/ml LBP-60, 40 nM exendin-4, 40 nM exendin-4 plus 0.75 mg/ml LBP-60, 500 ng/ml prolactin, and 500 ng/ml prolactin plus 0.75 mg/ml LBP-60 for 24 h, respectively. Untreated SJ β-cells (Blank) were served as control for each treatment group, except that two groups labeling by the line were compared with each other.

  • Prolactin Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Prolactin Protein, Human (HEK293, His)
  • Experimental Validation Results for Prolactin Protein, Human (HEK293, His)
  • Experimental Validation Results for Prolactin Protein, Human (HEK293, His)
  • Experimental Validation Results for Prolactin Protein, Human (HEK293, His)
  • Experimental Validation Results for Prolactin Protein, Human (HEK293, His)
  • Experimental Validation Results for Prolactin Protein, Human (HEK293, His)
  • Experimental Validation Results for Prolactin Protein, Human (HEK293, His)
  • Prolactin Protein, Human (HEK293, His) Product Image

  • Prolactin Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: bioRxiv. 2025 Oct 13.

    Prolactin Protein, Human (HEK293, His) (100 ng/m; 6 h) pretreated with JAK2/STAT3 inhibitor FLLL32 (10 μM) for 1 h significantly upregulated the mRNA expression of Ccl2 and Ccl7 in NIH-3T3 cells.

  • Prolactin Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: bioRxiv. 2025 Oct 13.

    Prolactin Protein, Human (HEK293, His) (0, 1, 10, and 100 ng/mL; 30 min) induced the activation of JAK2 and STAT3, rather than STAT1 and STAT5 in NIH-3T3 cells.

  • Prolactin Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: bioRxiv. 2025 Oct 13.

    Prolactin Protein, Human (HEK293, His) (100 ng/mL; 30 min)transfected with siRNA targeting Prlr or scrambled control for 24 h showed inhibition of the activation of JAK2 and STAT3 in Prlr knockdown cells.

  • Prolactin Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: bioRxiv. 2025 Oct 13.

    Prolactin Protein, Human (HEK293, His) (100 ng/mL; 24 h) induced CCL2 and CCL7 expression in human skin explant.

  • Prolactin Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: J Funct Foods. 2023 Aug, 107, 105706.

    Flow cytometry analysis of the percent of Ki67 positive cells (proliferative cells) from cultured SJ β-cells in response to 0.75 mg/ml dextran, 0.75 mg/ml LBP-60, 40 nM exendin-4, 40 nM exendin-4 plus 0.75 mg/ml LBP-60, 500 ng/ml prolactin, and 500 ng/ml prolactin plus 0.75 mg/ml LBP-60 for 24 h, respectively. Untreated SJ β-cells (Blank) were served as control for each treatment group, except that two groups labeling by the line were compared with each other.