RANTES/CCL5 Protein, Human (His-SUMO)

Customer Review

Based on 1 Customer Validation

RANTES/CCL5 Protein, Human (His-SUMO) is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis. RANTES/CCL5 Protein, Human (His-SUMO) is a recombinant human RANTES/CCL5 (S24-S91) protein expressed by  E. coli with a His and a SUMO tag at the N-terminu.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

RANTES/CCL5 Protein, Human (His-SUMO) is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis. RANTES/CCL5 Protein, Human (His-SUMO) is a recombinant human RANTES/CCL5 (S24-S91) protein expressed by  E. coli with a His and a SUMO tag at the N-terminu[1].

Background

CCL5, also known as RANTES (Regulation of Activation, Expression and Secretion by Normal T Cells), belongs to the CC subfamily of chemokines. The CCL5 gene is located in the q11.2-q12 region of human chromosome 17 and encodes CCL5 a protein with a molecular weight of 8 kDa. CCL5 can be expressed by T cells, monocytes, NK cells, epithelial cells, fibroblasts, and CCL5 can bind to receptors CCR1, CCR3, CCR4 and CCR5, with the highest affinity for CCR5[1]. CCL5 binding to CCR5 leads to phosphorylation of phosphatidylinositol 3-kinase ( PI3K ), and the phosphorylated PI3K further acidifies protein kinase B on serine 473, and the Akt/PKB complex phosphorylates and inactivates the serine/threonine protein kinase GSK-3. In parallel, CCL5 binding to CCR5 induces Bcl2 protein expression, which promotes cell apoptosis. CCL5 can also act as a potential agonist for the G protein-coupled receptor GPR75, which, together with GPR75, may play a role in neuronal survival by activating downstream signaling pathways involving PI3, Akt, and MAP kinases, and in insulin secretion by pancreatic islet cells by activating GPR75[2]. In addition to acting as a chemotactic agent, CCL5 is also a major HIV suppressor produced by CD8+ T cells. It is involved in inflammation maintenance, transplantation, antiviral immunity, tumor development, and many human diseases and disorders such as viral hepatitis or COVID-19[3].

Verified Bioactivity

Immobilized Human CCL5, His Tag at 0.5μg/ml (100μl/Well) on the plate. Dose response curve for Anti-CCL5 Antibody, hFc Tag with the EC50 of ≤8 ng/ml determined by ELISA.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-SUMO;N-6*His
  • Accession
  • Gene ID
  • Protein Length

    Full Length of C-C motif chemokine 5 Chain

  • Synonyms

    CCL5; T-Cell Specific Protein P288; Prev. D17S136E; C-C Motif Chemokine 5; Prev. SCYA5; MGC17164; TCP228; EoCP; SIS-Delta; Small Inducible Cytokine A5 (RANTES); RANTES; T-Cell Specific RANTES Protein; SISd; T-Cell-Specific Protein RANTES; Regulated Upon A

  • AA Sequence

    SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

  • Predicted Molecular Mass

    21 kDa

  • Molecular Weight

    Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris,0.3M NaCl, pH 8.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00