RBBP4 Protein, Mouse (sf9, His)
The RBBP4 protein is a core histone-binding subunit that directs chromatin regulators and histone deacetylases to their substrates and participates in chromatin metabolism.RBBP4 Protein, Mouse (sf9, His) is the recombinant mouse-derived RBBP4 protein, expressed by Sf9 insect cells , with N-His labeled tag.
- Species: Mouse
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The RBBP4 protein is a core histone-binding subunit that directs chromatin regulators and histone deacetylases to their substrates and participates in chromatin metabolism.RBBP4 Protein, Mouse (sf9, His) is the recombinant mouse-derived RBBP4 protein, expressed by Sf9 insect cells , with N-His labeled tag.
Background
RBBP4, as a core histone-binding subunit, plays a pivotal role in orchestrating the assembly and function of various chromatin-regulating complexes. It serves as a crucial mediator, directing chromatin assembly factors, chromatin remodeling factors, and histone deacetylases to their histone substrates, with regulatory nuances dictated by nucleosomal DNA. RBBP4 is integral to multiple complexes that govern chromatin metabolism, including the chromatin assembly factor 1 (CAF-1), core histone deacetylase (HDAC), nucleosome remodeling and histone deacetylase (NuRD), polycomb repressive complex 2 (PRC2), and nucleosome remodeling factor (NURF). In the CAF-1 complex, alongside CHAF1B and CHAF1A, RBBP4 contributes to chromatin assembly post-DNA replication and repair. As part of the HDAC complex, which includes HDAC1, HDAC2, and RBBP7, RBBP4 facilitates histone deacetylation and transcriptional repression. Additionally, in the NuRD complex, PRC2 complex, and NURF complex, RBBP4 engages in collaborative efforts with various subunits to modulate chromatin structure and gene expression. This multifaceted engagement highlights RBBP4's intricate role in epigenetic regulation, impacting diverse cellular processes.
Technical Parameters
-
Species Mouse
-
Source Sf9 insect cells
-
Tag N-His
-
Accession
Q60972 (M1-S425)
-
Molecular Construction
-
N-term
-
His
-
RBBP4 (M1-S425)
Accession # Q60972 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
RBBP4; Histone-Binding Protein RBBP4; RB Binding Protein 4, Chromatin Remodeling Factor; CAF-I 48 KDa Subunit; Retinoblastoma-Binding Protein 4; CAF-1 Subunit C; RbAp48; CAF-I P48; NURF55; RBBP-4; Lin-53; Chromatin Assembly Factor/CAF-1 P48 Subunit; Nucle
-
AA Sequence
MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS
-
Predicted Molecular Mass
50 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)