1. Recombinant Proteins
  2. Others
  3. RBBP4 Protein, Mouse (sf9, His)

The RBBP4 protein is a core histone-binding subunit that directs chromatin regulators and histone deacetylases to their substrates and participates in chromatin metabolism.RBBP4 Protein, Mouse (sf9, His) is the recombinant mouse-derived RBBP4 protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The RBBP4 protein is a core histone-binding subunit that directs chromatin regulators and histone deacetylases to their substrates and participates in chromatin metabolism.RBBP4 Protein, Mouse (sf9, His) is the recombinant mouse-derived RBBP4 protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

RBBP4, as a core histone-binding subunit, plays a pivotal role in orchestrating the assembly and function of various chromatin-regulating complexes. It serves as a crucial mediator, directing chromatin assembly factors, chromatin remodeling factors, and histone deacetylases to their histone substrates, with regulatory nuances dictated by nucleosomal DNA. RBBP4 is integral to multiple complexes that govern chromatin metabolism, including the chromatin assembly factor 1 (CAF-1), core histone deacetylase (HDAC), nucleosome remodeling and histone deacetylase (NuRD), polycomb repressive complex 2 (PRC2), and nucleosome remodeling factor (NURF). In the CAF-1 complex, alongside CHAF1B and CHAF1A, RBBP4 contributes to chromatin assembly post-DNA replication and repair. As part of the HDAC complex, which includes HDAC1, HDAC2, and RBBP7, RBBP4 facilitates histone deacetylation and transcriptional repression. Additionally, in the NuRD complex, PRC2 complex, and NURF complex, RBBP4 engages in collaborative efforts with various subunits to modulate chromatin structure and gene expression. This multifaceted engagement highlights RBBP4's intricate role in epigenetic regulation, impacting diverse cellular processes.

Species

Mouse

Source

Sf9 insect cells

Tag

N-His

Accession

Q60972 (M1-S425)

Gene ID
Molecular Construction
N-term
His
RBBP4 (M1-S425)
Accession # Q60972
C-term
Protein Length

Full Length

Synonyms
Histone-binding protein RBBP4; CAF-I p48; RBBP-4; RBAP48
AA Sequence

MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS

Predicted Molecular Mass
50 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

RBBP4 Protein, Mouse (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RBBP4 Protein, Mouse (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RBBP4 Protein, Mouse (sf9, His)
Cat. No.:
HY-P74600
Quantity:
MCE Japan Authorized Agent: