Renin Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
Renin Protein, a highly specific endopeptidase, generates angiotensin I from angiotensinogen, initiating a cascade that elevates blood pressure and enhances kidney sodium retention.Renin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Renin protein, expressed by HEK293 , with C-10*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Renin Protein, a highly specific endopeptidase, generates angiotensin I from angiotensinogen, initiating a cascade that elevates blood pressure and enhances kidney sodium retention.Renin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Renin protein, expressed by HEK293 , with C-10*His labeled tag.
Background
Renin Protein is a highly specific endopeptidase that serves a singular function of generating angiotensin I from angiotensinogen within the plasma. This enzymatic activity acts as the catalyst for a cascade of reactions, ultimately leading to an elevation in blood pressure and increased sodium retention by the kidney.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-10*His
-
Accession
P06281 (L22-R402)
-
Molecular Construction
-
N-term
-
Renin (L22-R402)
Accession # P06281 -
10*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
REN; Renin Precursor, Renal; Renin; ADTKD4; Angiotensinogenase; HNFJ2; Angiotensin-Forming Enzyme; RTD
-
AA Sequence
LPTRTATFERIPLKKMPSVREILEERGVDMTRLSAEWGVFTKRPSLTNLTSPVVLTNYLNTQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLACGIHSLYESSDSSSYMENGSDFTIHYGSGRVKGFLSQDSVTVGGITVTQTFGEVTELPLIPFMLAKFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEEVFSVYYNRGSHLLGGEVVLGGSDPQHYQGNFHYVSISKTDSWQITMKGVSVGSSTLLCEEGCAVVVDTGSSFISAPTSSLKLIMQALGAKEKRIEEYVVNCSQVPTLPDISFDLGGRAYTLSSTDYVLQYPNRRDKLCTLALHAMDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALAR
-
Molecular Weight
Approximately 41-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM HEPES, 8% trehalose, 4% mannitol, 0.02% Tween 20, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
