Renin Protein, Mouse (HEK293, His)

Renin Protein, a highly specific endopeptidase, generates angiotensin I from angiotensinogen, initiating a cascade that elevates blood pressure and enhances kidney sodium retention. Renin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Renin protein, expressed by HEK293 , with C-10*His labeled tag. The total length of Renin Protein, Mouse (HEK293, His) is 381 a.a., with molecular weight of 48-60 kDa.

Renin Protein is a highly specific endopeptidase that serves a singular function of generating angiotensin I from angiotensinogen within the plasma. This enzymatic activity acts as the catalyst for a cascade of reactions, ultimately leading to an elevation in blood pressure and increased sodium retention by the kidney.

Mouse

HEK293

C-10*His

P06281 (L22-R402)

19701  [NCBI]

LPTRTATFERIPLKKMPSVREILEERGVDMTRLSAEWGVFTKRPSLTNLTSPVVLTNYLNTQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLACGIHSLYESSDSSSYMENGSDFTIHYGSGRVKGFLSQDSVTVGGITVTQTFGEVTELPLIPFMLAKFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEEVFSVYYNRGSHLLGGEVVLGGSDPQHYQGNFHYVSISKTDSWQITMKGVSVGSSTLLCEEGCAVVVDTGSSFISAPTSSLKLIMQALGAKEKRIEEYVVNCSQVPTLPDISFDLGGRAYTLSSTDYVLQYPNRRDKLCTLALHAMDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALAR

48-60 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.