RSK1 Protein, Human (sf9)

RSK1 is a kinase downstream of ERK signaling and is critical for mitosis and stress-induced responses. It activates transcription factors (CREB1, ETV1, NR4A1), affecting proliferation, survival and differentiation. RSK1 Protein, Human (sf9) is the recombinant human-derived RSK1 protein, expressed by sf9 insect cells , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

RSK1 is a kinase downstream of ERK signaling and is critical for mitosis and stress-induced responses. It activates transcription factors (CREB1, ETV1, NR4A1), affecting proliferation, survival and differentiation. RSK1 Protein, Human (sf9) is the recombinant human-derived RSK1 protein, expressed by sf9 insect cells , with tag free.

Background

RSK1, a serine/threonine-protein kinase, functions downstream of ERK (MAPK1/ERK2 and MAPK3/ERK1) signaling and plays a crucial role in mediating mitogenic and stress-induced cellular responses. RSK1 orchestrates the activation of transcription factors such as CREB1, ETV1/ER81, and NR4A1/NUR77, contributing to cellular proliferation, survival, and differentiation. Through its intricate involvement in the mTOR signaling pathway, RSK1 regulates translation by phosphorylating RPS6 and EIF4B, facilitating the assembly of pre-initiation complexes and enhancing cap-dependent translation. Furthermore, RSK1 exerts its influence on various cellular processes, including inhibiting the pro-apoptotic functions of BAD and DAPK1, promoting cell survival, and regulating cell cycle progression by phosphorylating CDKN1B. In response to insulin, RSK1 indirectly modulates gene transcription by phosphorylating GSK3B, and in the mTOR nutrient-sensing pathway, it phosphorylates TSC2 and RPTOR, influencing mTORC1 activity. Additionally, RSK1 participates in the feedback regulation of mTORC1 and mTORC2 by phosphorylating DEPTOR. Notably, during microbial infections, RSK1 is implicated in promoting the late transcription and translation of viral lytic genes in Kaposi's sarcoma-associated herpesvirus/HHV-8 infection when constitutively activated.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • RSK1 (Q33-T353)
      Accession # Q15418
    • C-term
  • Protein Length

    Partial

  • Synonyms

    RPS6KA1; MAPKAPK1A; Ribosomal Protein S6 Kinase A1; P90-RSK 1; RSK1; P90RSK1; MAPKAPK1; P90S6K; P90Rsk; RSK-1; HU-1; DJ590P13.1 (Ribosomal Protein S6 Kinase, 90kD, Polypeptide 1); MAP Kinase-Activated Protein Kinase 1a; Ribosomal Protein S6 Kinase, 90kDa,

  • AA Sequence

    QPSKDEGVLKEISITHHVKAGSEKADPSHFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMERDILADVNHPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHSHSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQSLLRALFKRNPANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKPAVAQPDDTFYFDT

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00