RSK1 Protein, Human (sf9)
RSK1 is a kinase downstream of ERK signaling and is critical for mitosis and stress-induced responses. It activates transcription factors (CREB1, ETV1, NR4A1), affecting proliferation, survival and differentiation. RSK1 Protein, Human (sf9) is the recombinant human-derived RSK1 protein, expressed by sf9 insect cells , with tag free.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
RSK1 is a kinase downstream of ERK signaling and is critical for mitosis and stress-induced responses. It activates transcription factors (CREB1, ETV1, NR4A1), affecting proliferation, survival and differentiation. RSK1 Protein, Human (sf9) is the recombinant human-derived RSK1 protein, expressed by sf9 insect cells , with tag free.
Background
RSK1, a serine/threonine-protein kinase, functions downstream of ERK (MAPK1/ERK2 and MAPK3/ERK1) signaling and plays a crucial role in mediating mitogenic and stress-induced cellular responses. RSK1 orchestrates the activation of transcription factors such as CREB1, ETV1/ER81, and NR4A1/NUR77, contributing to cellular proliferation, survival, and differentiation. Through its intricate involvement in the mTOR signaling pathway, RSK1 regulates translation by phosphorylating RPS6 and EIF4B, facilitating the assembly of pre-initiation complexes and enhancing cap-dependent translation. Furthermore, RSK1 exerts its influence on various cellular processes, including inhibiting the pro-apoptotic functions of BAD and DAPK1, promoting cell survival, and regulating cell cycle progression by phosphorylating CDKN1B. In response to insulin, RSK1 indirectly modulates gene transcription by phosphorylating GSK3B, and in the mTOR nutrient-sensing pathway, it phosphorylates TSC2 and RPTOR, influencing mTORC1 activity. Additionally, RSK1 participates in the feedback regulation of mTORC1 and mTORC2 by phosphorylating DEPTOR. Notably, during microbial infections, RSK1 is implicated in promoting the late transcription and translation of viral lytic genes in Kaposi's sarcoma-associated herpesvirus/HHV-8 infection when constitutively activated.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
Q15418 (Q33-T353)
-
Gene ID6195
-
Molecular Construction
-
N-term
-
RSK1 (Q33-T353)
Accession # Q15418 -
C-term
-
-
Protein Length
Partial
-
Synonyms
RPS6KA1; MAPKAPK1A; Ribosomal Protein S6 Kinase A1; P90-RSK 1; RSK1; P90RSK1; MAPKAPK1; P90S6K; P90Rsk; RSK-1; HU-1; DJ590P13.1 (Ribosomal Protein S6 Kinase, 90kD, Polypeptide 1); MAP Kinase-Activated Protein Kinase 1a; Ribosomal Protein S6 Kinase, 90kDa,
-
AA Sequence
QPSKDEGVLKEISITHHVKAGSEKADPSHFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMERDILADVNHPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHSHSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQSLLRALFKRNPANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKPAVAQPDDTFYFDT
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)