S100A11 Protein, Human

S100A11 Protein facilitates keratinocyte differentiation and cornification, forming homodimers via disulfide linkages. S100A11 Protein, Human is the recombinant human-derived S100A11 protein, expressed by E. coli , with tag free. The total length of S100A11 Protein, Human is 105 a.a., with molecular weight of ~12 kDa.

S100A11 Protein plays a role in facilitating the differentiation and cornification of keratinocytes. It forms homodimers through disulfide linkages.

Human

E. coli

Tag Free

P31949 (M1-T105)

6282  [NCBI]

MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT

Approximately 12 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS,1 mM DTT, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.