S100A11 Protein, Human
Based on 1 Customer Validation
S100A11 Protein facilitates keratinocyte differentiation and cornification, forming homodimers via disulfide linkages. S100A11 Protein, Human is the recombinant human-derived S100A11 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
S100A11 Protein facilitates keratinocyte differentiation and cornification, forming homodimers via disulfide linkages. S100A11 Protein, Human is the recombinant human-derived S100A11 protein, expressed by E. coli , with tag free.
Background
S100A11 Protein plays a role in facilitating the differentiation and cornification of keratinocytes. It forms homodimers through disulfide linkages.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P31949 (M1-T105)
-
Molecular Construction
-
N-term
-
S100A11 (M1-T105)
Accession # P31949 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
S100A11; MLN70; S100 Calcium Binding Protein A11; S100 Calcium-Binding Protein A11 (Calgizzarin); S100C; Epididymis Secretory Protein Li 43; Calgizzarin; S100 Calcium-Binding Protein A11; Metastatic Lymph Node Gene 70 Protein; S100 Calcium-Binding Protein
-
AA Sequence
MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT
-
Predicted Molecular Mass
11.7 kDa
-
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS,1 mM DTT, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (232 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)