S100A6 Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The S100A6 protein is a key calcium sensor that actively promotes cellular calcium signaling and is involved in multiple processes, including actin cytoskeletal reorganization and cell motility. As a homodimer binding two calcium ions, it interacts with TPR-containing proteins, CACYBP, ANXA2, ANXA11, SUGT1, tropomyosin, TP53, PPP5C, and TPPP. S100A6 Protein, Human (His) is the recombinant human-derived S100A6 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The S100A6 protein is a key calcium sensor that actively promotes cellular calcium signaling and is involved in multiple processes, including actin cytoskeletal reorganization and cell motility. As a homodimer binding two calcium ions, it interacts with TPR-containing proteins, CACYBP, ANXA2, ANXA11, SUGT1, tropomyosin, TP53, PPP5C, and TPPP. S100A6 Protein, Human (His) is the recombinant human-derived S100A6 protein, expressed by E. coli , with N-6*His labeled tag.

Background

The S100A6 Protein serves as a pivotal calcium sensor and modulator, actively contributing to cellular calcium signaling. Through interactions with various proteins, including TPR-containing proteins, S100A6 indirectly participates in diverse physiological processes, such as the reorganization of the actin cytoskeleton and cell motility. Existing as a homodimer with a head-to-tail assembly of two subunits, S100A6 binds two calcium ions in a cooperative manner. Its calcium-dependent interaction with CACYBP, ANXA2, ANXA11, SUGT1, and tropomyosin reveals its role in orchestrating complex molecular interactions. Moreover, S100A6 interacts with TP53, displaying higher affinity for TP53 phosphorylated on its N-terminal domain and lower affinity for TP53 phosphorylated on its C-terminal domain. The interaction with PPP5C, mediated by TPR repeats, is calcium-dependent and modulates PPP5C activity, emphasizing S100A6's regulatory influence in cellular processes. Additionally, its interaction with TPPP inhibits TPPP dimerization, as reported in recent studies.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • S100A6 (M1-G90)
      Accession # P06703
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    S100A6; Protein S100-A6; Prev. CACY; S100 Calcium-Binding Protein A6 (Calcyclin); PRA; S100 Calcium-Binding Protein A6; Calcyclin; S100 Calcium-Binding Protein; CABP; Protein S100; 2A9; S10A6; Prolactin Receptor-Associated Protein; 5B10; Growth Factor-Ind

  • AA Sequence

    MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

  • Predicted Molecular Mass

    12.5 kDa

  • Molecular Weight

    Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 20% glycerol, 1 mM EDTA, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00