SCGN Protein, Human (His)

Customer Review

Based on 1 Customer Validation

SCGN Protein is a calcium-sensor protein with a regulatory role in glucose metabolism and the secretion of several peptide hormones. Secretagogin (SCGN) is a three-domain hexa-EF-hand Ca2+-binding protein. SCGN is a Ca2+-dependent generic molecular chaperone involved in protein homeostasis with broad substrate specificity. The overexpression of SCGN efficiently prevents cells from heat shock and oxidative damage. SCGN enhances pancreatic insulin secretion and is a useful biomarker of endocrine tumors, stroke, and psychiatric conditions. SCGN Protein, Human (His) is the recombinant human-derived SCGN protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

SCGN Protein is a calcium-sensor protein with a regulatory role in glucose metabolism and the secretion of several peptide hormones. Secretagogin (SCGN) is a three-domain hexa-EF-hand Ca2+-binding protein. SCGN is a Ca2+-dependent generic molecular chaperone involved in protein homeostasis with broad substrate specificity. The overexpression of SCGN efficiently prevents cells from heat shock and oxidative damage. SCGN enhances pancreatic insulin secretion and is a useful biomarker of endocrine tumors, stroke, and psychiatric conditions[1][2][3]. SCGN Protein, Human (His) is the recombinant human-derived SCGN protein, expressed by E. coli , with N-His labeled tag.

Background

Secretagogin (SCGN) is a biomarker of neuroendocrine cells, and a gene product of the SCGN gene located on chromosome 6p22.3-p22.1. SCGN is a calcium binding protein that is highly expressed in neuroendocrine cells, and six EF-hand calcium-binding proteins are postulated to be involved in transmitting calcium signals to control cell proliferation. SCGN enhances pancreatic insulin secretion, and is a useful biomarker for endocrine tumors, stroke, and psychiatric conditions. SCGN also exerts a neuroprotective role in neurodegenerative diseases, such as Alzheimer's disease. In addition, RIN-5F insulinoma cell clones exhibit retarded cell growth following overexpression of SCGN, suggesting their involvement in growth control and differentiation or inhibition of cell replication by Ca2+ signal modulation[1].
extracellular SCGN is readily internalized into the C2C12 cells in an energy-dependent manner. SCGN internalizes via clathrin-mediated endocytosis, following which, SCGN localizes largely in the cytosol. Exogenous SCGN treatment induces a global proteomic reprogramming in C2C12 cells[2].
SCGN is expressed largely in pancreatic β-cells, certain parts of the brain, and also in neuroendocrine tissues. The expression of SCGN is altered in several diseases, such as diabetes, cancers, and neurodegenerative disorders. In the presence of Ca2+, SCGN efficiently prevents the aggregation of a broad range of model proteins in vitro. Ca2+ induces the conversion of a closed compact apo-SCGN conformation into an open extended holo-SCGN conformation via multistate intermediates, consistent with the augmentation of chaperone activity of SCGN[3].

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • SCGN (D2-P276)
      Accession # O76038
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    SCGN; SEGN; Secretagogin, EF-Hand Calcium Binding Protein; Secretagogin; SECRET; Setagin; DJ501N12.8; Calbindin-Like; CALBL

  • AA Sequence

    DSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP

  • Molecular Weight

    Approximately 32 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00