1. Recombinant Proteins
  2. Others
  3. Thioredoxin/TXN Protein, Human

Thioredoxin/TXN protein participates in multiple redox reactions, utilizing its active center dithiol for reversible oxidation and disulfide bond formation. It catalyzes important dithiol-disulfide exchange and plays a key role in S-nitrosylation of cysteine residues in response to intracellular nitric oxide. Thioredoxin/TXN Protein, Human is the recombinant human-derived Thioredoxin/TXN protein, expressed by E. coli , with tag free.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Größe Preis Verfügbarkeit Menge
Kostenlose Probe   Apply now
5 μg Auf Lager
10 μg Auf Lager
50 μg Auf Lager
100 μg Auf Lager
500 μg Auf Lager
> 500 μg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Thioredoxin/TXN Protein, Human

  • Biologische Aktivität

  • Technical Parameters

  • Properties

  • Beschreibung

Beschreibung

Thioredoxin/TXN protein participates in multiple redox reactions, utilizing its active center dithiol for reversible oxidation and disulfide bond formation. It catalyzes important dithiol-disulfide exchange and plays a key role in S-nitrosylation of cysteine residues in response to intracellular nitric oxide. Thioredoxin/TXN Protein, Human is the recombinant human-derived Thioredoxin/TXN protein, expressed by E. coli , with tag free.

Background

Thioredoxin/TXN Protein actively engages in diverse redox reactions, employing the reversible oxidation of its active center dithiol to form a disulfide bond, and catalyzes crucial dithiol-disulfide exchange reactions. Beyond its classical redox functions, Thioredoxin plays a pivotal role in the reversible S-nitrosylation of cysteine residues within target proteins, contributing to the cellular response to intracellular nitric oxide. Notably, it exerts regulatory control over caspase-3 activity by nitrosylating the active site cysteine of CASP3 in response to nitric oxide. Moreover, Thioredoxin demonstrates its influence on the FOS/JUN AP-1 DNA-binding activity in ionizing radiation cells, modulating AP-1 transcriptional activity through its oxidation/reduction status. Additionally, Thioredoxin is implicated in the augmentation of interleukin-2 receptor TAC (IL2R/P55) expression, highlighting its multifaceted role in cellular processes beyond redox regulation.

Biologische Aktivität

Measured by its ability to catalyze the reduction of insulin. The reaction leads toprecipitation, which can be measured by absorbance at 650 nm and the specific activity is 5-11 A650/min/mg.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P10599 (M1-V105)

Gene ID

7295

Molecular Construction
N-term
TXN (M1-V105)
Accession # P10599
C-term
Protein Length

Full Length

Synonyms
Thioredoxin; TXN; Trx; ADF; TRX1; SASP
AA Sequence

MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Predicted Molecular Mass
11.7 kDa
Molekulargewicht

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Reinheit
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Versand

Room temperature in continental US; may vary elsewhere.

Dokumentation

Thioredoxin/TXN Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

Thioredoxin/TXN Protein, Human

 

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

     

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
Thioredoxin/TXN Protein, Human
Art. -Nr.:
HY-P73431A
Menge:
MCE Japan Authorized Agent: