TMEM175 Protein, Human (HEK293)
Based on 1 Customer Validation
TMEM175 Protein, Human (HEK293) is the recombinant human-derived TMEM175, expressed by HEK293 , with tag Free labeled tag. ,
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
TMEM175 Protein, Human (HEK293) is the recombinant human-derived TMEM175, expressed by HEK293 , with tag Free labeled tag. ,
TMEM175 is a proton-activated proton channel that facilitates proton efflux from endosomes and lysosomes to maintain steady-state pH. It is activated at low pH (below 4.6) and selectively mediates lysosomal proton release, balancing V-ATPase activity for pH homeostasis (by similar: PubMed:35750034). Additionally, TMEM175 functions as a potassium channel at higher pH, regulating potassium conductance in endosomes and lysosomes. It serves as the pore-forming subunit of the lysoK(GF) complex, which consists of TMEM175 and AKT (AKT1, AKT2, or AKT3) and is activated by extracellular growth factors. The lysoK(GF) complex opens the TMEM175 channel via AKT-induced conformational changes, activating its function and playing a critical role in protecting neurons from stress-induced damage (by similar: PubMed:33505021).
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
Q9BSA9-1 (M1-C504)
-
Gene ID84286
-
Protein Length
Full Length of Isoform-1
-
Synonyms
TMEM175; MGC4618; Transmembrane Protein 175; HTMEM175; Endosomal/Lysosomal Proton Channel TMEM175; Endosomal/Lysomomal Potassium Channel TMEM175; Potassium Channel TMEM175; Endosomal/Lysosomal Potassium Channel TMEM175
-
AA Sequence
MSQPRTPEQALDTPGDCPPGRRDEDAGEGIQCSQRMLSFSDALLSIIATVMILPVTHTEISPEQQFDRSVQRLLATRIAVYLMTFLIVTVAWAAHTRLFQVVGKTDDTLALLNLACMMTITFLPYTFSLMVTFPDVPLGIFLFCVCVIAIGVVQALIVGYAFHFPHLLSPQIQRSAHRALYRRHVLGIVLQGPALCFAAAIFSLFFVPLSYLLMVTVILLPYVSKVTGWCRDRLLGHREPSAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLVAALSATGPRFLAYFGSFATVGLLWFAHHSLFLHVRKATRAMGLLNTLSLAFVGGLPLAYQQTSAFARQPRDELERVRVSCTIIFLASIFQLAMWTTALLHQAETLQPSVWFGGREHVLMFAKLALYPCASLLAFASTCLLSRFSVGIFHLMQIAVPCAFLLLRLLVGLALATLRVLRGLARPEHPPPAPTGQDDPQSQLLPAPC
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 8.0, 150 mM KCl, 2 mM DTT, 0.1% (w/v) LMNG.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
