TRBC2 Protein, Human (Biotinylated, HEK293, His-Avi)

TRBC2 Protein, Human (Biotinylated, HEK293, His, Avi) is the recombinant human-derived TRBC2 protein, expressed by HEK293, with C-His & C-Avi tag.

TRBC2 is the constant region of the T cell receptor (TR) beta chain (PubMed:24600447). Alpha-beta T cell receptors are antigen-specific receptors essential for immune responses and are expressed on the surface of T lymphocytes. They recognize peptide-major histocompatibility (pMH) complexes displayed by antigen-presenting cells (APCs), a prerequisite for efficient T cell adaptive immunity against pathogens (PubMed:25493333). Binding of alpha-beta TR to pMH triggers TR-CD3 clustering on the cell surface and intracellular activation of LCK, which phosphorylates ITAM motifs in CD3G, CD3D, CD3E, and CD247, enabling ZAP70 recruitment. ZAP70 then phosphorylates LAT, forming the LAT signalosome that recruits multiple signaling molecules, branching into three major pathways: calcium signaling, mitogen-activated protein kinase (MAPK), and nuclear factor NF-kappa-B (NF-κB). These pathways mobilize transcription factors critical for gene expression, T cell growth, and differentiation (PubMed:23524462). The T cell receptor repertoire is generated in the thymus via V-(D)-J rearrangement and shaped by intrathymic selection to produce a peripheral T cell pool with self-MHC restriction and non-autoaggressive properties. Post-thymic interactions between alpha-beta TR and pMH further refine TR structural and functional avidity (PubMed:15040585).

Human

HEK293

C-His;C-Avi

A0A5B9 (D1-A144)

/

Partial

Biotin

The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

DLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSA

Approximately 21-22 kDa & 25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/molt-4-cell.html  [Content Brief]