TRBC2 Protein, Human (Biotinylated, HEK293, His-Avi)
TRBC2 Protein, Human (Biotinylated, HEK293, His, Avi) is the recombinant human-derived TRBC2 protein, expressed by HEK293, with C-His & C-Avi tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
TRBC2 Protein, Human (Biotinylated, HEK293, His, Avi) is the recombinant human-derived TRBC2 protein, expressed by HEK293, with C-His & C-Avi tag.
Background
TRBC2 is the constant region of the T cell receptor (TR) beta chain (PubMed:24600447). Alpha-beta T cell receptors are antigen-specific receptors essential for immune responses and are expressed on the surface of T lymphocytes. They recognize peptide-major histocompatibility (pMH) complexes displayed by antigen-presenting cells (APCs), a prerequisite for efficient T cell adaptive immunity against pathogens (PubMed:25493333). Binding of alpha-beta TR to pMH triggers TR-CD3 clustering on the cell surface and intracellular activation of LCK, which phosphorylates ITAM motifs in CD3G, CD3D, CD3E, and CD247, enabling ZAP70 recruitment. ZAP70 then phosphorylates LAT, forming the LAT signalosome that recruits multiple signaling molecules, branching into three major pathways: calcium signaling, mitogen-activated protein kinase (MAPK), and nuclear factor NF-kappa-B (NF-κB). These pathways mobilize transcription factors critical for gene expression, T cell growth, and differentiation (PubMed:23524462). The T cell receptor repertoire is generated in the thymus via V-(D)-J rearrangement and shaped by intrathymic selection to produce a peripheral T cell pool with self-MHC restriction and non-autoaggressive properties. Post-thymic interactions between alpha-beta TR and pMH further refine TR structural and functional avidity (PubMed:15040585).
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His;C-Avi
-
Accession
A0A5B9 (D1-A144)
-
Gene ID/
-
Molecular Construction
-
N-term
-
TRBC2 (D1-A144)
Accession # A0A5B9 -
His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
TRBC2; TCRBC2; T Cell Receptor Beta Constant 2; V_segment Translation Product
-
AA Sequence
DLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSA
-
Predicted Molecular Mass
20 kDa
-
Molecular Weight
Approximately 21-22 kDa & 25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)