TRBC2 Protein, Human (Biotinylated, HEK293, His-Avi)

TRBC2 Protein, Human (Biotinylated, HEK293, His, Avi) is the recombinant human-derived TRBC2 protein, expressed by HEK293, with C-His & C-Avi tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TRBC2 Protein, Human (Biotinylated, HEK293, His, Avi) is the recombinant human-derived TRBC2 protein, expressed by HEK293, with C-His & C-Avi tag.

Background

TRBC2 is the constant region of the T cell receptor (TR) beta chain (PubMed:24600447). Alpha-beta T cell receptors are antigen-specific receptors essential for immune responses and are expressed on the surface of T lymphocytes. They recognize peptide-major histocompatibility (pMH) complexes displayed by antigen-presenting cells (APCs), a prerequisite for efficient T cell adaptive immunity against pathogens (PubMed:25493333). Binding of alpha-beta TR to pMH triggers TR-CD3 clustering on the cell surface and intracellular activation of LCK, which phosphorylates ITAM motifs in CD3G, CD3D, CD3E, and CD247, enabling ZAP70 recruitment. ZAP70 then phosphorylates LAT, forming the LAT signalosome that recruits multiple signaling molecules, branching into three major pathways: calcium signaling, mitogen-activated protein kinase (MAPK), and nuclear factor NF-kappa-B (NF-κB). These pathways mobilize transcription factors critical for gene expression, T cell growth, and differentiation (PubMed:23524462). The T cell receptor repertoire is generated in the thymus via V-(D)-J rearrangement and shaped by intrathymic selection to produce a peripheral T cell pool with self-MHC restriction and non-autoaggressive properties. Post-thymic interactions between alpha-beta TR and pMH further refine TR structural and functional avidity (PubMed:15040585).

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His;C-Avi
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • TRBC2 (D1-A144)
      Accession # A0A5B9
    • His-Avi
    • C-term
  • Protein Length

    Extracellular Domain

  • Conjugation

    Biotin

  • Synonyms

    TRBC2; TCRBC2; T Cell Receptor Beta Constant 2; V_segment Translation Product

  • AA Sequence

    DLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSA

  • Predicted Molecular Mass

    20 kDa

  • Molecular Weight

    Approximately 21-22 kDa & 25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00