VSIG2 Protein, Human (HEK293, His)
Based on 1 Customer Validation
VSIG2 is also known as CTXL (cortical thymocyte like-protein). VSIG2 promotes malignant progression of pancreatic ductal adenocarcinoma through LAMtor2-mediated mTOR activation. VSIG2 can be used as a potential biomarker or therapeutic target for tumors. VSIG2 Protein, Human (HEK293, His) is the recombinant human-derived VSIG2 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
VSIG2 is also known as CTXL (cortical thymocyte like-protein). VSIG2 promotes malignant progression of pancreatic ductal adenocarcinoma through LAMtor2-mediated mTOR activation. VSIG2 can be used as a potential biomarker or therapeutic target for tumors. VSIG2 Protein, Human (HEK293, His) is the recombinant human-derived VSIG2 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
V-set and immunoglobulin domain-containing protein 2, also known as corticothymocyte-like protein, CT-like protein and VSIG2, is a single-generation type I membrane protein. VSIG2 is highly expressed in the stomach and colon and weakly expressed in the bladder and lungs. VSIG2 is associated with immune invasion and antigen presentation of colon cancer (COAD), and it can be used as a potential biomarker or therapeutic target for COAD. VSIG2 promotes the malignant progression of pancreatic ductal adenocarcinoma through LAMtor2-mediated mTOR activation. VISG2 has been associated with a variety of diseases, in corneal samples from Fuchs patients with endothelial corneal dystrophy (FECD), in intestinal biopsies from patients with irritable bowel syndrome (IBS-D), in plasma from patients with acute tubule injury and interstitial fibrosis/tubular atrophy, and in plasma from patients with sudden heart failure. VSIG2 was found to be significantly upregulated[1][2][3].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q96IQ7-1 (V24-A243)
-
Molecular Construction
-
N-term
-
VSIG2 (V24-A243)
Accession # Q96IQ7-1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
VSIG2; V-Set And Immunoglobulin Domain Containing 2; CTXL; CTH; V-Set And Immunoglobulin Domain-Containing Protein 2; Cortical Thymocyte-Like Protein; CT-Like Protein; Cortical Thymocyte Receptor (X. Laevis CTX) Like; 2210413P10Rik
-
AA Sequence
VEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISESHPILYFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLTVLVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQGRVA
-
Predicted Molecular Mass
24.2 kDa
-
Molecular Weight
Approximately 24-36 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.
2.Lyophilized from a 0.2 μm filtered solution of 20 mM Citrate, 8% trehalose, 0.02% Tween 20, pH 5.0.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
