VSIG2 Protein, Human (Biotinylated, HEK293, His)

VSIG2 is also known as CTXL (cortical thymocyte like-protein). VSIG2 promotes malignant progression of pancreatic ductal adenocarcinoma through LAMtor2-mediated mTOR activation. VSIG2 can be used as a potential biomarker or therapeutic target for tumors. VSIG2 Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived VSIG2 protein, expressed by HEK293 , with C-His labeled tag.

V-set and immunoglobulin domain-containing protein 2, also known as corticothymocyte-like protein, CT-like protein and VSIG2, is a single-generation type I membrane protein. VSIG2 is highly expressed in the stomach and colon and weakly expressed in the bladder and lungs. VSIG2 is associated with immune invasion and antigen presentation of colon cancer (COAD), and it can be used as a potential biomarker or therapeutic target for COAD. VSIG2 promotes the malignant progression of pancreatic ductal adenocarcinoma through LAMtor2-mediated mTOR activation. VISG2 has been associated with a variety of diseases, in corneal samples from Fuchs patients with endothelial corneal dystrophy (FECD), in intestinal biopsies from patients with irritable bowel syndrome (IBS-D), in plasma from patients with acute tubule injury and interstitial fibrosis/tubular atrophy, and in plasma from patients with sudden heart failure. VSIG2 was found to be significantly upregulated^[1][2][3].

Human

HEK293

C-His

Q96IQ7-1 (V24-A243)

23584  [NCBI]

Extracellular Domain

Biotin

The biotin is covalently conjugated to the primary amine groups of the protein using chemical labeling methods.

VEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISESHPILYFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLTVLVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQGRVA

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Cui Z, et al. Key Candidate Genes - VSIG2 of Colon Cancer Identified by Weighted Gene Co-Expression Network Analysis. Cancer Manag Res. 2021 Jul 15;13:5739-5750.  [Content Brief]

  [2]. Xu J, et al. VSIG2 promotes malignant progression of pancreatic ductal adenocarcinoma by enhancing LAMTOR2-mediated mTOR activation. Cell Commun Signal. 2023 Aug 25;21(1):223.  [Content Brief]

  [3]. Zhou X, et al. V-Set and immunoglobulin domain containing (VSIG) proteins as emerging immune checkpoint targets for cancer immunotherapy. Front Immunol. 2022 Sep 15;13:938470.  [Content Brief]