Copy Link Print Information

14-3-3 eta Protein, Human (GST)

Customer Review

Based on 1 Customer Validation

YWHAH proteins are adapter proteins in multiple signaling pathways that recognize phosphoserine or phosphothreonine motifs and regulate chaperone activity upon binding. It negatively regulates PDPK1 kinase activity and interacts with nuclear hormone receptors (AR, ESR1, ESR2, MC2R, NR3C1, NRIP1, PPARBP, THRA) and cofactors. 14-3-3 eta Protein, Human (GST) is the recombinant human-derived YWHAH protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • 14-3-3 eta Protein, Human (GST) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

YWHAH proteins are adapter proteins in multiple signaling pathways that recognize phosphoserine or phosphothreonine motifs and regulate chaperone activity upon binding. It negatively regulates PDPK1 kinase activity and interacts with nuclear hormone receptors (AR, ESR1, ESR2, MC2R, NR3C1, NRIP1, PPARBP, THRA) and cofactors. 14-3-3 eta Protein, Human (GST) is the recombinant human-derived YWHAH protein, expressed by E. coli , with N-GST labeled tag.

Background

The YWHAH protein functions as an adapter implicated in the regulation of a broad spectrum of both general and specialized signaling pathways, recognizing phosphoserine or phosphothreonine motifs to bind with numerous partners. This binding typically leads to the modulation of the activity of the interacting partner. YWHAH negatively regulates the kinase activity of PDPK1 and exists as a homodimer. It interacts with various nuclear hormone receptors and cofactors, including AR, ESR1, ESR2, MC2R, NR3C1, NRIP1, PPARBP, and THRA. Additionally, it interacts with ABL1 in its phosphorylated form, retaining it in the cytoplasm, and weakly interacts with CDKN1B. Other interactions involve ARHGEF28, CDK16, GAB2, KCNK18 (in a phosphorylation-dependent manner), SAMSN1, the 'Ser-241' phosphorylated form of PDPK1, the 'Thr-369' phosphorylated form of DAPK2, PI4KB, TBC1D22A, TBC1D22B, SLITRK1, and MEFV. These diverse interactions underscore the multifaceted role of YWHAH in various cellular processes and signaling pathways.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-GST
  • Accession

    Q04917 (R4-N246)

  • Gene ID
    7533  [NCBI]
  • Molecular Construction
    • N-term
    • GST
    • YWHAH (R4-N246)
      Accession # Q04917
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    YWHAH; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein Eta; YWHA1; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein; Eta Polypeptide; 14-3-3 Protein Eta; 14-3-3 Eta; Protein AS1

  • AA Sequence

    REQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

  • Predicted Molecular Mass

    54.9 kDa

  • Molecular Weight

    Approximately 55 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 14-3-3 eta Protein, Human (GST) Product Image
    1/16
  • 14-3-3 eta Protein, Human (GST) Product Image