[Tyr0] Corticotropin Releasing Factor, ovine acetate
Based on 1 Customer Validation
[Tyr0] Corticotropin Releasing Factor, ovine acetate is a corticotropin releasing factor/hormone isolated from ovine. Corticotropin releasing factor (CRF) is a hypothalamic hormone, stimulates the release of adrenocorticotropic hormone (ACTH) and of β-endorphin.
For research use only. We do not sell to patients.
- Formula: C214H348N60O65S·xC2H4O2
- Molecular Weight:4833.48 (free base)
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
![[Tyr0] Corticotropin Releasing Factor, ovine acetate Chemical Structure](https://file.medchemexpress.com/product_pic/hy-p3687a.gif "Click to View [Tyr0] Corticotropin Releasing Factor, ovine acetate Chemical Structure")
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Description
In Vitro
[Tyr0] Corticotropin Releasing Factor, ovine acetate has a strong binding effect with plasma protein[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
Molecular Weight 4833.48 (free base)
-
Formula C214H348N60O65S·xC2H4O2
-
Sequence
Tyr-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2
-
Sequence Shortening
YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
In Vitro:
DMSO : 100 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Purity & Documentation
References
[1]. Schulte HM, et al. Metabolic clearance rate and plasma half-life of radioiodinated corticotropin releasing factor in a primate. J Clin Endocrinol Metab. 1982 Nov;55(5):1023-5. [Content Brief]
[2]. Rebaudo R, et al. Electrophysiological effects of sustained delivery of CRF and its receptor agonists in hippocampal slices. Brain Res. 2001 Dec 13;922(1):112-7. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
[Tyr0] Corticotropin Releasing Factor, ovine acetate Related Classifications
HY-P3687A Related Classifications
Powered by Bioz