[Tyr0] Corticotropin Releasing Factor, ovine
[Tyr0] Corticotropin Releasing Factor, ovine is a corticotropin releasing factor/hormone isolated from ovine. Corticotropin releasing factor (CRF) is a hypothalamic hormone, stimulates the release of adrenocorticotropic hormone (ACTH) and of β-endorphin.
For research use only. We do not sell to patients.
- CAS No.: 83930-34-1
- Formula: C214H348N60O65S
- Molecular Weight:4833.48
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
![[Tyr0] Corticotropin Releasing Factor, ovine Chemical Structure](https://file.medchemexpress.com/product_pic/hy-p3687.gif "Click to View [Tyr0] Corticotropin Releasing Factor, ovine Chemical Structure")
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Description
In Vitro
[Tyr0] Corticotropin Releasing Factor, ovine has a strong binding effect with plasma protein[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 83930-34-1
-
Molecular Weight 4833.48
-
Formula C214H348N60O65S
-
Sequence
Tyr-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2
-
Sequence Shortening
YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. Schulte HM, et al. Metabolic clearance rate and plasma half-life of radioiodinated corticotropin releasing factor in a primate. J Clin Endocrinol Metab. 1982 Nov;55(5):1023-5. [Content Brief]
[2]. Rebaudo R, et al. Electrophysiological effects of sustained delivery of CRF and its receptor agonists in hippocampal slices. Brain Res. 2001 Dec 13;922(1):112-7. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
[Tyr0] Corticotropin Releasing Factor, ovine Related Classifications
HY-P3687 Related Classifications
Powered by Bioz