Adrenomedullin (AM) (1-52), human TFA
Based on 1 publication(s) in Google Scholar
Adrenomedullin (AM) (1-52), human (TFA) affects cell proliferation and angiogenesis in cancer.
For research use only. We do not sell to patients.
- Purity: 99.94%
- Formula: C264H406N80O77S3.xC2HF3O2
- Molecular Weight:6028.82 (free base)
-
Storage:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications Citing Use of MedChemExpress (MCE) Adrenomedullin (AM) (1-52), human TFA
More
Biological Activity
Description
In Vitro
To explore the effect of Adrenomedullin (AM) (1-52), human on astroglioma cells, CRT-MG cells are incubated in the absence or presence of Adrenomedullin (AM) (1-52), human (ADM1-52) for 48 h in a medium containing 1% FBS, and wound-healing assay is performed. The number of cells migrating to the wound region significantly increases in the ADM1-52-treated cells, in a dose-dependent manner, compared to the untreated cells[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
Molecular Weight 6028.82 (free base)
-
Formula C264H406N80O77S3.xC2HF3O2
-
Color White to off-white
-
Synonyms
Human adrenomedullin-(1-52)-NH2 TFA
-
Sequence
Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys16-Cys21)
-
Sequence Shortening
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: Cys16-Cys21)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications (1)
-
Journal Impact Factor
-
Most Recent
Solvent & Solubility
In Vitro:
DMSO : 25 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Protocol
Cell Assay[1]
CRT-MG cells are scraped off the bottom of a culture plate using a pipette tip to create a cell-free area. The cell culture is washed with PBS to remove cell debris and then incubated with oncostatin M (OSM), Adrenomedullin (AM) (1-52), human (ADM1-52; 0.1 μM and 0.5 μM) for 48 h in 1% FBS DMEM. The wound area is photographed after scratching for control. The number of cells migrating into the initial wound area is counted at 48 h after scratching[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Purity & Documentation
-
Data Sheet (268 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)