β-CGRP, human TFA
Based on 2 publication(s) in Google Scholar
β-CGRP, human TFA (Human β-CGRP TFA) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells.
For research use only. We do not sell to patients.
- Purity : 99.57%
- Formula: C162H267N51O48S3.xC2HF3O2
- Molecular Weight:3793.41 (free base)
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications Citing Use of MedChemExpress (MCE) β-CGRP, human TFA
More
Biological Activity
Description
IC50 & Target
IC50: 1 nM (CRLR/RAMP1, cell assay), 300 nM (CRLR/RAMP2, cell assay)[1]
In Vitro
β-CGRP, human is one of calcitonin peptides, acts via complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM in both SK-N-MC and Swiss 3T3 cells express CRLR and RAMP1, and 130 nM and 300 nM in NG108-15 and HEK293T cells expressing CRLR and RAMP2[1]. CGRP is a potent vasodilator and also shows pro- and -anti-inflammatory activity[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
Molecular Weight 3793.41 (free base)
-
Formula C162H267N51O48S3.xC2HF3O2
-
Color White to off-white
-
Synonyms
Human β-CGRP TFA; CGRP-II (Human) TFA
-
Sequence
Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2(Disulfide bridge: Cys2-Cys7)
-
Sequence Shortening
ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2(Disulfide bridge: Cys2-Cys7)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
-
Mol Med Rep
Calcitonin gene‑related peptide alleviates hyperoxia‑induced human alveolar cell injury via the CGRPR/TRPV1/Ca2+ axis. [Abstract]2024 Jul;30(1):110. PMID: 38695251
Solvent & Solubility
In Vitro:
H2O : 100 mg/mL (Need ultrasonic)
In Vivo:
For the following dissolution methods, please prepare the working solution directly:
It is recommended to prepare fresh solutions and use them promptly within a short period of time.
The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.
Add each solvent one by one: PBS
Solubility: 50 mg/mL; Clear solution; Need ultrasonic
Purity & Documentation
-
Data Sheet (269 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. McLatchie LM, et al. RAMPs regulate the transport and ligand specificity of the calcitonin-receptor-like receptor. Nature. 1998 May 28;393(6683):333-9. [Content Brief]
[2]. Russell FA, et al. Calcitonin gene-related peptide: physiology and pathophysiology. Physiol Rev. 2014 Oct;94(4):1099-142. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)