1. GPCR/G Protein
    Neuronal Signaling
  2. CGRP Receptor
  3. β-CGRP, human TFA

β-CGRP, human TFA (Synonyms: Human β-CGRP (TFA); CGRP-II (Human) (TFA))

Cat. No.: HY-P1548A Purity: 98.82%
Handling Instructions

β-CGRP, human TFA is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

β-CGRP, human TFA Chemical Structure

β-CGRP, human TFA Chemical Structure

Size Price Stock Quantity
500 μg USD 150 In-stock
Estimated Time of Arrival: December 31
1 mg USD 270 In-stock
Estimated Time of Arrival: December 31
5 mg USD 940 In-stock
Estimated Time of Arrival: December 31
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Other Forms of β-CGRP, human TFA:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Information

  • Purity & Documentation

  • References

Description

β-CGRP, human TFA is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells[1].

IC50 & Target

IC50: 1 nM (CRLR/RAMP1, cell assay), 300 nM (CRLR/RAMP2, cell assay)[1]

In Vitro

β-CGRP, human is one of calcitonin peptides, acts via complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM in both SK-N-MC and Swiss 3T3 cells express CRLR and RAMP1, and 130 nM and 300 nM in NG108-15 and HEK293T cells expressing CRLR and RAMP2[1]. CGRP is a potent vasodilator and also shows pro- and -anti-inflammatory activity[2].

Storage
Powder -80°C 2 years
  -20°C 1 year
In solvent -80°C 6 months
  -20°C 1 month
Solvent & Solubility
In Vitro: 

H2O : ≥ 50 mg/mL (12.80 mM)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2559 mL 1.2796 mL 2.5593 mL
5 mM 0.0512 mL 0.2559 mL 0.5119 mL
10 mM 0.0256 mL 0.1280 mL 0.2559 mL
*Please refer to the solubility information to select the appropriate solvent.
References
Molecular Weight

3907.38

Formula

C₁₆₄H₂₆₈F₃N₅₁O₅₀S₃

Sequence

Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2(Disulfide bridge: Cys2-Cys7)

Sequence Shortening

ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2(Disulfide bridge: Cys2-Cys7)

Shipping

Room temperature in continental US; may vary elsewhere

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
β-CGRP, human TFA
Cat. No.:
HY-P1548A
Quantity:

β-CGRP, human TFA

Cat. No.: HY-P1548A