1. Peptides
  2. Amylin (8-37), rat

Amylin (8-37), rat (Synonyms: Amylin (8-37) (mouse, rat))

Cat. No.: HY-P1473
Handling Instructions

Amylin (8-37), rat is a truncated analog of native Amylin that selectively inhibits insulin-related glucose uptake and glycogen deposition in muscle tissue. Amylin (8-37), rat is a weak amylin receptor (AMY) antagonist.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Amylin (8-37), rat Chemical Structure

Amylin (8-37), rat Chemical Structure

CAS No. : 138398-61-5

Size Price Stock
500 μg USD 160 Ask For Quote & Lead Time
1 mg USD 260 Ask For Quote & Lead Time
5 mg USD 960 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Amylin (8-37), rat is a truncated analog of native Amylin that selectively inhibits insulin-related glucose uptake and glycogen deposition in muscle tissue. Amylin (8-37), rat is a weak amylin receptor (AMY) antagonist.

IC50 & Target

Amylin receptor (AMY)[1]

In Vitro

Amylin (8-37), rat (Rat amylin-(8-37)) enhances insulin action and alters lipid metabolism in normal and insulin-resistant rats. Amylin (8-37) reduces plasma insulin (P<0.001) and enhances several measures of whole body and muscle insulin sensitivity (P<0.05) in both saline- and hGH-infused rats. Amylin-(8-37) corrects hGH-induced liver insulin resistance, increases basal plasma triglycerides and lowers plasma nonesterified fatty acids in both groups, and reduces muscle triglyceride and total long-chain acyl-CoA content in saline-treated rats (P<0.05). In isolated soleus muscle, Amylin (8-37) blocks amylin-induced inhibition of glycogen synthesis but has no effect in the absence of amylin. Thus 1) hyperamylinemia accompanies insulin resistance induced by hGH infusion; 2) Amylin (8-37) increases whole body and muscle insulin sensitivity and consistently reduces basal insulin levels in normal and hGH-induced insulin resistant rats; and 3) Amylin (8-37) elicits a significant alteration of in vivo lipid metabolism[2].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3200.61

Formula

C₁₄₀H₂₂₇N₄₃O₄₃

CAS No.

138398-61-5

Sequence

Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2

Sequence Shortening

ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Solvent & Solubility
In Vitro: 

H2O

Peptide Solubility and Storage Guidelines:

1.  Calculate the length of the peptide.

2.  Calculate the overall charge of the entire peptide according to the following table:

  Contents Assign value
Acidic amino acid Asp (D), Glu (E), and the C-terminal -COOH. -1
Basic amino acid Arg (R), Lys (K), His (H), and the N-terminal -NH2 +1
Neutral amino acid Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) 0

3.  Recommended solution:

Overall charge of peptide Details
Negative (<0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, add NH4OH (<50 μL).
3.  If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
Positive (>0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, try dissolving the peptide in a 10%-30% acetic acid solution.
3.  If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
Zero (=0) 1.  Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first.
2.  For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

Amylin (8-37), ratAmylin (8-37) (mouse, rat)OthersInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Amylin (8-37), rat
Cat. No.:
HY-P1473
Quantity:
MCE Japan Authorized Agent: