1. Peptides
  2. Amylin (IAPP), feline

Amylin (IAPP), feline 

Cat. No.: HY-P1871
Handling Instructions

Amylin (IAPP), feline, a 37-amino acid polypeptide. Amylin (IAPP) is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP) is a regulatory peptide, which inhibits insulin and glucagon secretion.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Amylin (IAPP), feline Chemical Structure

Amylin (IAPP), feline Chemical Structure

Size Stock
1 mg   Get quote  
5 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Amylin (IAPP), feline, a 37-amino acid polypeptide. Amylin (IAPP) is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP) is a regulatory peptide, which inhibits insulin and glucagon secretion[1].

Molecular Weight

3910.45

Formula

C₁₆₅H₂₇₀N₅₂O₅₄S₂

Sequence

{Lys}{Cys}{Asn}{Thr}{Ala}{Thr}{Cys}{Ala}{Thr}{Gln}{Arg}{Leu}{Ala}{Asn}{Phe}{Leu}{Ile}{Arg}{Ser}{Ser}{Asn}{Asn}{Leu}{Gly}{Ala}{Ile}{Leu}{Ser}{Pro}{Thr}{Asn}{Val}{Gly}{Ser}{Asn}{Thr}{Tyr}-NH2 (Disulfide bridge: Cys2-Cys7)

Sequence Shortening

KCNTATCATQRLANFLIRSSNNLGAILSPTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7)

Shipping

Room temperature in continental US; may vary elsewhere

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Amylin (IAPP), feline
Cat. No.:
HY-P1871
Quantity: