1802086-22-1
Chemical Structure
(Glu20)-Amyloid β-Protein (1-42)
- CAS No.: 1802086-22-1
- Formula:C199H309N55O62S
- Molecular Weight:4495.98
SMILES: [DAEFRHDSGYEVHHQKLVFEAEDVGSNKGAIIGLMVGGVVIA]
Biological Activity: (Glu20)-Amyloid β-Protein (1-42) is a slower fibrillizing variant of amyloid β-protein (Aβ). The Glu20 mutation reduces the aggregation propensity of Aβ42 and prevents accumulation of the slowly fibrillizing peptide. Amyloid β-protein is the primary component of both vascular and parenchymal amyloid deposits in Alzheimer's disease[1][2].
| Cat. No. | Product Name | Purity | Description | Pricing | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
(Glu20)-Amyloid β-Protein (1-42) | (Glu20)-Amyloid β-Protein (1-42) is a slower fibrillizing variant of amyloid β-protein (Aβ). The Glu20 mutation reduces the aggregation propensity of Aβ42 and prevents accumulation of the slowly fibrillizing peptide. Amyloid β-protein is the primary component of both vascular and parenchymal amyloid deposits in Alzheimer's disease. | |||||||||||||||||||||
|
loading...
/
|
|||||||||||||||||||||||
References
- [1]. Poduslo JF, et al. Receptor-mediated transport of human amyloid beta-protein 1-40 and 1-42 at the blood-brain barrier. Neurobiol Dis. 1999 Jun;6(3):190-9. [Content Brief]
- [2]. Williams TL, et al. The effect of Alzheimer's Aβ aggregation state on the permeation of biomimetic lipid vesicles. Langmuir. 2010 Nov 16;26(22):17260-8. [Content Brief]