(Glu20)-Amyloid β-Protein (1-42)
(Glu20)-Amyloid β-Protein (1-42) is a slower fibrillizing variant of amyloid β-protein (Aβ). The Glu20 mutation reduces the aggregation propensity of Aβ42 and prevents accumulation of the slowly fibrillizing peptide. Amyloid β-protein is the primary component of both vascular and parenchymal amyloid deposits in Alzheimer's disease.
For research use only. We do not sell to patients.
- CAS No.: 1802086-22-1
- Formula: C199H309N55O62S
- Molecular Weight:4495.98
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
Description
Chemical Information
-
CAS No. 1802086-22-1
-
Molecular Weight 4495.98
-
Formula C199H309N55O62S
-
Sequence Shortening
DAEFRHDSGYEVHHQKLVFEAEDVGSNKGAIIGLMVGGVVIA
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. Poduslo JF, et al. Receptor-mediated transport of human amyloid beta-protein 1-40 and 1-42 at the blood-brain barrier. Neurobiol Dis. 1999 Jun;6(3):190-9. [Content Brief]
[2]. Williams TL, et al. The effect of Alzheimer's Aβ aggregation state on the permeation of biomimetic lipid vesicles. Langmuir. 2010 Nov 16;26(22):17260-8. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)