Citrullinated LL-37 1cit
Citrullinated LL-37 1cit is a citrullinated LL-37 (HY-P1222) peptide. Citrullinated LL-37 1cit does not alter the antiviral effect of LL-37 toward human rhinovirus. Citrullinated LL-37 1cit shows antibacterial activity toward S. aureus. Citrullinated LL-37 1cit causes a reduction in the levels of IL-8, CCL5, and IL-6 mRNA induced by RV1B.
For research use only. We do not sell to patients.
- Formula: C205H339N59O54
- Molecular Weight:4494.25
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Human rhinovirus, S. aureus[1]
Chemical Information
-
Molecular Weight 4494.25
-
Formula C205H339N59O54
-
Sequence
Leu-Leu-Gly-Asp-Phe-Phe-{Cit}-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
-
Sequence Shortening
LLGDFF-{Cit}-KSKEKIGKEFKRIVQRIKDFLRNLVPRTES
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Citrullinated LL-37 1cit Related Classifications
HY-P5836 Related Classifications
Powered by Bioz