Cy5-β-Amyloid (42-1), human Tris
Cy5-β-Amyloid (42-1), human is a Cy5 fluorescently-labelled β-Amyloid (42-1, human) peptide (λex= 633 nm and λem= 670 nm). β-Amyloid (42-1), human is the inactive form of Amyloid β Peptide (1-42). Its active form, β-Amyloid (1-42), may play a key role in the pathogenesis of Alzheimer's disease.
For research use only. We do not sell to patients.
- Formula: C236H349N57O67S3·xC4H11NO3
- Molecular Weight:5152.83 (free base)
-
Storage:
-20°C, sealed storage, away from moisture and light
* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Biological Activity
Chemical Information
-
Appearance Solid
-
Molecular Weight 5152.83 (free base)
-
Formula C236H349N57O67S3·xC4H11NO3
-
Color Light blue to blue
-
Synonyms
Cy5-Amyloid β Peptide (42-1)(human) Tris
-
Sequence
{CY5}-Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp
-
Sequence Shortening
{CY5}-AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
-20°C, sealed storage, away from moisture and light
* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Solvent & Solubility
H2O : 20 mg/mL (Need ultrasonic)
Purity & Documentation
-
Data Sheet (286 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)