country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P1362FA

Copy Link Print Information

Cy5-β-Amyloid (42-1), human TFA

Name: Cy5-β-Amyloid (42-1), human TFA
Brand: MedChemExpress
SKU: HY-P1362FA
Price: 750.00 USD
Availability: PreOrder

(Synonyms: Cy5-Amyloid β Peptide (42-1)(human) (TFA)

Cy5-β-Amyloid (42-1), human is a Cy5 fluorescently-labelled β-Amyloid (42-1, human) peptide (λ_ex= 633 nm and λ_em= 670 nm). β-Amyloid (42-1), human is the inactive form of Amyloid β Peptide (1-42). Its active form, β-Amyloid (1-42), may play a key role in the pathogenesis of Alzheimer's disease.

For research use only. We do not sell to patients.

Formula: C₂₃₆H₃₄₉N₅₇O₆₇S₃·xC₂HF₃O₂
Molecular Weight:5152.83 (free base)

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

Cy5-β-Amyloid (42-1), human TFA Chemical Structure

Size

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

Description

Cy5-β-Amyloid (42-1), human is a Cy5 fluorescently-labelled β-Amyloid (42-1, human) peptide (λ_ex= 633 nm and λ_em= 670 nm)^[1]. β-Amyloid (42-1), human is the inactive form of Amyloid β Peptide (1-42). Its active form, β-Amyloid (1-42), may play a key role in the pathogenesis of Alzheimer's disease.

Chemical Information

Molecular Weight 5152.83 (free base)
Formula C₂₃₆H₃₄₉N₅₇O₆₇S₃·xC₂HF₃O₂
Synonyms

Cy5-Amyloid β Peptide (42-1)(human) (TFA
Sequence

{CY5}-Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp
Sequence Shortening

{CY5}-AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (285 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Jungbauer LM, et al. Preparation of fluorescently-labeled amyloid-beta peptide assemblies: the effect of fluorophore conjugation on structure and function. J Mol Recognit. 2009 Sep-Oct;22(5):403-13. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Bioz

Keywords

MOQ

Minimum order quantity

100 mg

Get Quote In-stock

Other size

Get Quote